BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30346 (447 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81109-11|CAB03254.2| 318|Caenorhabditis elegans Hypothetical p... 27 6.2 Z71264-1|CAA95828.1| 998|Caenorhabditis elegans Hypothetical pr... 27 6.2 >Z81109-11|CAB03254.2| 318|Caenorhabditis elegans Hypothetical protein R10D12.11 protein. Length = 318 Score = 27.1 bits (57), Expect = 6.2 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 160 VFEFVTGVGSMEARFVTCR-SFQXIKPPEKTLARSRR*RAY 279 + F TGVG + A T + I PP LARS R +A+ Sbjct: 92 IIGFGTGVGMLSACIQTIQYRHSKIVPPNSILARSSRIKAF 132 >Z71264-1|CAA95828.1| 998|Caenorhabditis elegans Hypothetical protein K07G5.1 protein. Length = 998 Score = 27.1 bits (57), Expect = 6.2 Identities = 24/102 (23%), Positives = 40/102 (39%), Gaps = 2/102 (1%) Frame = +1 Query: 124 LRTISKLSNSRIVFEFVTGVGSMEARFVTCRSFQXIKPPEKTLARSRR*RAYCPDSGARL 303 ++ I +S +V GV + + C + + L+ + Y PD G L Sbjct: 79 IKAIHVISEEELVIHLDDGVHKKKIN-IKCSIHPAVHLARQLLSAVKH---YFPDFGVYL 134 Query: 304 KHFSPPRXHXLVLRWPSTNSARPSGLSTMNRTYYAL--FWNQ 423 + L +PS +A P + RTY AL F++Q Sbjct: 135 QSSIDVNPSALYTEFPSLPTASPRPCHSFRRTYAALCDFYDQ 176 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,346,224 Number of Sequences: 27780 Number of extensions: 207707 Number of successful extensions: 425 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 777938954 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -