BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30336 (562 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 2.8 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 2.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.8 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 503 RWLLELIDTYNVIAR 459 R L +L+DTYNV+ R Sbjct: 26 RLLNDLLDTYNVLER 40 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 177 PCSTRXELNLLYNLKRTSAI 236 P EL +LYN KRT+ I Sbjct: 161 PGKVLGELAILYNCKRTATI 180 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 2.8 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 416 QRLPRPSDRNALL-LHGSNRQGGGTYPCGLTR 324 ++LP ++ LL L+G NR+ G Y C + R Sbjct: 372 RQLPGTGRQSELLRLNGINREDRGMYQCIVRR 403 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 2.8 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 416 QRLPRPSDRNALL-LHGSNRQGGGTYPCGLTR 324 ++LP ++ LL L+G NR+ G Y C + R Sbjct: 372 RQLPGTGRQSELLRLNGINREDRGMYQCIVRR 403 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,478 Number of Sequences: 438 Number of extensions: 2329 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -