BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30335 (707 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2497| Best HMM Match : C2 (HMM E-Value=2.3e-06) 28 6.5 SB_26951| Best HMM Match : CUB (HMM E-Value=0) 28 8.5 >SB_2497| Best HMM Match : C2 (HMM E-Value=2.3e-06) Length = 466 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 436 GLSVVTMTTPYFKPKRITASRQK*EGGSTYPCGLTKGPTISKKLGSTKNIVHI 594 G+ T +F+P R R E S CGL + P+I +K +T V + Sbjct: 354 GIDDFQRTDVHFRPTRANLDRIPKEAKSARSCGLNQLPSIPQKQRNTIETVSL 406 >SB_26951| Best HMM Match : CUB (HMM E-Value=0) Length = 794 Score = 27.9 bits (59), Expect = 8.5 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +2 Query: 131 PFTVFTVFYSIF*KFHINNNIS*VSYICFLYIKSHNLAEII*RCWFYIKAYVGLVCVSVW 310 P TV + S++ KFH N N++ ++ Y + + I+ F +GL+ V V Sbjct: 711 PGTVTSSESSMYIKFHSNGNVTAAGFMA-TYTSAWSTRTIVLIAVFSCAGVIGLIAVLVA 769 Query: 311 C 313 C Sbjct: 770 C 770 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,651,878 Number of Sequences: 59808 Number of extensions: 352457 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -