BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30332 (596 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05540.1 68416.m00607 translationally controlled tumor family... 56 1e-08 At3g16640.1 68416.m02127 translationally controlled tumor family... 56 2e-08 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 34 0.063 At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR... 31 0.58 At1g63910.1 68414.m07236 myb family transcription factor (MYB103... 28 5.4 At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V)... 27 7.2 At2g39380.1 68415.m04833 exocyst subunit EXO70 family protein co... 27 9.5 >At3g05540.1 68416.m00607 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 156 Score = 56.4 bits (130), Expect = 1e-08 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 1/86 (1%) Frame = +3 Query: 255 VDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILG 434 VDI+ RL E +F DKK + +++K Y+K+L KL+ + E+FK ++ K ++ Sbjct: 55 VDIIDTFRLQEQPSF-DKKQFVMFMKRYIKQLSPKLDS---ENQELFKKHIESATKFLMS 110 Query: 435 RFKELQFFTGESMDC-DGMVAMMEYR 509 + K+ QFF GESM+ +G + YR Sbjct: 111 KLKDFQFFVGESMEGEEGSLVFAYYR 136 Score = 36.7 bits (81), Expect = 0.012 Identities = 18/52 (34%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +1 Query: 61 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSA 213 M +Y+DI+TGDE+ SD++ K ++ +++EV G+ + +G + EG + A Sbjct: 1 MLVYQDILTGDELLSDSFPYKEIENGMLWEVEGKNPSGEEGG-EDEGVDDQA 51 >At3g16640.1 68416.m02127 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 168 Score = 56.0 bits (129), Expect = 2e-08 Identities = 28/66 (42%), Positives = 44/66 (66%), Gaps = 3/66 (4%) Frame = +1 Query: 61 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEG 231 M +Y+D++TGDE+ SD++ K ++ +++EV G+ VT D+ I G NPSAEE DEG Sbjct: 1 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNI-GANPSAEEGGEDEG 59 Query: 232 TDSAVE 249 D + + Sbjct: 60 VDDSTQ 65 Score = 54.4 bits (125), Expect = 5e-08 Identities = 34/85 (40%), Positives = 44/85 (51%) Frame = +3 Query: 255 VDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILG 434 VDIV RL E + DKK + Y+K Y+K L KL E+ DQ VFK + K +L Sbjct: 68 VDIVDTFRLQEQPTY-DKKGFIAYIKKYIKLLTPKLSEE--DQA-VFKKGIEGATKFLLP 123 Query: 435 RFKELQFFTGESMDCDGMVAMMEYR 509 R + QFF GE M D + Y+ Sbjct: 124 RLSDFQFFVGEGMHDDSTLVFAYYK 148 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 34.3 bits (75), Expect = 0.063 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +1 Query: 88 GDEMFSDTYKMKLVDEVIYEVT--GRLVTRAQGDIQIEGFNPSAEEADEGTDSAVESG 255 G+ S K +++D V+ +T G +T +G+ EGF P+AEEAD+G S + G Sbjct: 238 GEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGE---EGFLPTAEEADDGIGSMMMGG 292 >At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1355 Score = 31.1 bits (67), Expect = 0.58 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 333 DYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ-FFTGESMD 476 D M+ + KL P +EVFK+N N + ++ F ++ FF GE D Sbjct: 226 DKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKAD 274 >At1g63910.1 68414.m07236 myb family transcription factor (MYB103) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 370 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -3 Query: 171 SRHQPTGHFVNNFIDQFHFVGVREHLITSDNVLIDLHFDGLEAIKNNKNRKN 16 SRHQP+ V D E T+ + + +LHFDG N N N Sbjct: 124 SRHQPSVTTVTLNADTTSIATTIEASTTTTSTIDNLHFDGFTDSPNQLNFTN 175 >At5g49030.1 68418.m06067 tRNA synthetase class I (I, L, M and V) family protein similar to SP|P41972 Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA ligase) (IleRS) {Staphylococcus aureus}; contains Pfam profile PF00133: tRNA synthetases class I (I, L, M and V) Length = 1093 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +3 Query: 405 MNKVMKDILGRFKELQFFTGE---SMDCDGM 488 +NK++KDI+ R+K LQ + + DC G+ Sbjct: 167 LNKILKDIINRYKLLQNYKVQYVPGWDCHGL 197 >At2g39380.1 68415.m04833 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 637 Score = 27.1 bits (57), Expect = 9.5 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 3/77 (3%) Frame = -1 Query: 584 SNI*NSLLLDH-V*KTS*LVFAYHQSPIFH--HGNHAITIHRLPSKELKFLKPAEDVFHY 414 S + + +L +H + K + ++ +Y +PI H NHA+++H L L FL + Sbjct: 395 SRVLSEILAEHPLKKNTRMLESYFTAPILEDEHNNHAVSVH-LAWLILIFLCKLDIKAES 453 Query: 413 FVHVCFKYFNLVRRLLF 363 + V Y LV + F Sbjct: 454 YKDVSLSYLFLVNNIQF 470 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,645,350 Number of Sequences: 28952 Number of extensions: 255347 Number of successful extensions: 666 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -