BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30331 (380 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC800.06 |brx1||ribosome biogenesis protein Brx1|Schizosacchar... 27 0.75 SPBC13E7.01 |cwf22|SPBC15D4.16|splicing factor Cwf22|Schizosacch... 27 0.99 SPAC13G7.01c |erg7|SPAC4G9.21c|lanosterol synthase Erg7 |Schizos... 27 1.3 SPAC1B1.04c |||poly|Schizosaccharomyces pombe|chr 1|||Manual 25 3.0 SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe... 25 4.0 SPAPB1A10.12c |alo1||D-arabinono-1,4-lactone oxidase|Schizosacch... 25 5.3 SPBPJ4664.01 |dps1|SPBPJ694.01|decaprenyl diphosphate synthase s... 25 5.3 SPAC12G12.15 |sif3||Sad1 interacting factor 3|Schizosaccharomyce... 25 5.3 SPBC354.13 |rga6||GTPase activating protein Rga6|Schizosaccharom... 24 7.0 SPBC947.04 |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual 24 9.3 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 24 9.3 >SPBC800.06 |brx1||ribosome biogenesis protein Brx1|Schizosaccharomyces pombe|chr 2|||Manual Length = 295 Score = 27.5 bits (58), Expect = 0.75 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%) Frame = +3 Query: 57 CGHTFVGTSVNRPLVYHHDVQY-SSKMFRKRVENLHFSLPHVPSIFGRSIQG---ILAFD 224 C + F S R +Y H + + + VENLH ++ + ++ G +++G IL+FD Sbjct: 95 CNNIFFFESRRREDLYLHIARAPNGPTVKFHVENLH-TMDEL-NMTGNALKGSRPILSFD 152 Query: 225 KTYSTA 242 KT+ TA Sbjct: 153 KTFDTA 158 >SPBC13E7.01 |cwf22|SPBC15D4.16|splicing factor Cwf22|Schizosaccharomyces pombe|chr 2|||Manual Length = 834 Score = 27.1 bits (57), Expect = 0.99 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 191 EYGRYMRQAEMEVFNSLTEHFRAVLH 114 E G Y+ + +N + E FR +LH Sbjct: 260 EIGAYLAEVSTRAYNGVFERFRTILH 285 >SPAC13G7.01c |erg7|SPAC4G9.21c|lanosterol synthase Erg7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 721 Score = 26.6 bits (56), Expect = 1.3 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +3 Query: 72 VGTSVNRPLVYHHDVQYSSKMFRKRVENLH-FSLPHVPSIFGRSIQGILAFDKTYS 236 V ++N VY H+ SSK F+K ++ LH F + R G+ ++ +++ Sbjct: 336 VNAAMNTVCVYFHEGP-SSKAFQKHIQRLHDFMWVQPEGMLMRGTNGLQVWETSFT 390 >SPAC1B1.04c |||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 25.4 bits (53), Expect = 3.0 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 108 HDVQYSSKMFRKRVENLHFSLP 173 +D+ ++S +FRKR + +FS P Sbjct: 309 YDLFFASPVFRKRTSSFYFSQP 330 >SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe|chr 2|||Manual Length = 687 Score = 25.0 bits (52), Expect = 4.0 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -1 Query: 188 YGRYMRQAEMEVFNSLTEHFRAVLHVMV 105 YGR M+ E + + +H+RAV ++ Sbjct: 649 YGRLMQSEHTETSDMMEQHYRAVTQYLL 676 >SPAPB1A10.12c |alo1||D-arabinono-1,4-lactone oxidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 461 Score = 24.6 bits (51), Expect = 5.3 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 147 VENLHFSLPHVPSIFGRSIQGILA 218 ++NL +SLP V SI S+ GI++ Sbjct: 107 LQNLGYSLPIVGSISETSVSGIMS 130 >SPBPJ4664.01 |dps1|SPBPJ694.01|decaprenyl diphosphate synthase subunit Dps1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 378 Score = 24.6 bits (51), Expect = 5.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 134 HFRAVLHVMVVDQGPIDAGADESVTAFHDHRS 39 H ++LH V+D + G+ S AF + RS Sbjct: 130 HIASLLHDDVIDHANVRRGSPSSNVAFGNRRS 161 >SPAC12G12.15 |sif3||Sad1 interacting factor 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 510 Score = 24.6 bits (51), Expect = 5.3 Identities = 8/31 (25%), Positives = 21/31 (67%) Frame = +3 Query: 108 HDVQYSSKMFRKRVENLHFSLPHVPSIFGRS 200 H +++ K+ K+ + + +++ H+P ++GRS Sbjct: 161 HFLKHYHKVRAKKYDEVLYAVYHLPLVYGRS 191 >SPBC354.13 |rga6||GTPase activating protein Rga6|Schizosaccharomyces pombe|chr 2|||Manual Length = 733 Score = 24.2 bits (50), Expect = 7.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 135 FRKRVENLHFSLPHVPSIFGRSIQGILAFDKT 230 F R + H ++ H PS+FG+ I G L D T Sbjct: 282 FPHRNAHQHNAIAHNPSVFGKPI-GDLTSDPT 312 >SPBC947.04 |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual Length = 973 Score = 23.8 bits (49), Expect = 9.3 Identities = 14/59 (23%), Positives = 25/59 (42%) Frame = -1 Query: 296 SCGD*RSYSRFRLGDVRRSSAIGLVEGQNALNGPPEYGRYMRQAEMEVFNSLTEHFRAV 120 +C D R Y R GD+ ++ EG YG + ++++ T F+A+ Sbjct: 891 TCCDERPYYRTMEGDLAKTYFFIEDEGDGTYKFKLTYGAFSEYLDVKILADSTFFFKAM 949 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 23.8 bits (49), Expect = 9.3 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 130 KCSVRELKTSISACLMYLPYSGGPFRAFWPST 225 +CS+ EL+T +++ L P F F PS+ Sbjct: 177 ECSLSELQTIVTSLLAEHPSLAHEFHNFLPSS 208 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,496,255 Number of Sequences: 5004 Number of extensions: 28390 Number of successful extensions: 86 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 124270298 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -