BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30330 (501 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4XTD9 Cluster: Putative uncharacterized protein; n=1; ... 34 2.1 UniRef50_Q4XY64 Cluster: Putative uncharacterized protein; n=1; ... 33 4.8 >UniRef50_Q4XTD9 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 441 Score = 33.9 bits (74), Expect = 2.1 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +3 Query: 108 SVHCNKKIVTSIARIYVYFILLNFLFAIIYF*ACVFRRKLKKREEFVKCLGVINKIQL-K 284 S++ +K T I ++I ++F IY A + KLKK + +KC+ IN+ QL Sbjct: 366 SLYICEKYETIIEHYKYHYIYIDFYLTYIYLKALI---KLKKYNDCLKCIFDINRQQLDP 422 Query: 285 VKKCI 299 + KCI Sbjct: 423 LNKCI 427 >UniRef50_Q4XY64 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 47 Score = 32.7 bits (71), Expect = 4.8 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +2 Query: 137 FYCPHICLFYFIKFFICHNLFLSLCV 214 F+ P + + YF+ F+I ++F+SLC+ Sbjct: 22 FFIPRLRILYFLSFYIKFSIFISLCI 47 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 422,767,668 Number of Sequences: 1657284 Number of extensions: 7115314 Number of successful extensions: 19038 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19029 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29691847201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -