BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30329 (634 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 3.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.9 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 6.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 6.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.5 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 8.6 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.6 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 283 ENRRYFAQLLAQSLQNMQPQRRKNTI 206 +NR FA + S++N P RR++ + Sbjct: 9 KNREMFAIKKSYSIENGYPARRRSLV 34 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 563 PPFSTRAAPPT*TQSPFMCHLSPWLFL 483 PP+ +PP + F+ H W++L Sbjct: 442 PPYLFFESPPVVFLNDFISHQHAWIWL 468 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 563 PPFSTRAAPPT*TQSPFMCHLSPWLFL 483 PP+ +PP + F+ H W++L Sbjct: 442 PPYLFFESPPVVFLNDFISHQHAWIWL 468 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 563 PPFSTRAAPPT*TQSPFMCHLSPWLFL 483 PP+ +PP + F+ H W++L Sbjct: 442 PPYLFFESPPVVFLNDFISHQHAWIWL 468 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -3 Query: 563 PPFSTRAAPPT*TQSPFMCHLSPWLFL 483 PP+ +PP + F+ H W++L Sbjct: 442 PPYLFFESPPVVFLNDFISHQHAWIWL 468 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 LIS*NVLDVIQISIEKLSFAELLGSGLF 320 LI ++ D ++ KLSF ++G G F Sbjct: 435 LIKPDIFDQWELGPLKLSFQGVIGEGAF 462 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 196 RMWLLYSFVAGVACFVGF 249 R + +Y+FVA V C F Sbjct: 51 RTYFIYAFVAPVKCLAFF 68 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = -3 Query: 563 PPFSTRAAPPT*TQSPFMCHLSPWLFL 483 PP+ PP F+ H W++L Sbjct: 196 PPYLFFVPPPLMFLQDFLSHQHAWIWL 222 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 196 RMWLLYSFVAGVACFVGF 249 R + +Y+FVA V C F Sbjct: 284 RTYFIYAFVAPVKCLAFF 301 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = -3 Query: 563 PPFSTRAAPPT*TQSPFMCHLSPWLFL 483 PP+ PP F+ H W++L Sbjct: 429 PPYLFFVPPPLMFLQDFLSHQHAWIWL 455 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 196 RMWLLYSFVAGVACFVGF 249 R + +Y+FVA V C F Sbjct: 284 RTYFIYAFVAPVKCLAFF 301 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = -3 Query: 563 PPFSTRAAPPT*TQSPFMCHLSPWLFL 483 PP+ PP F+ H W++L Sbjct: 429 PPYLFFVPPPLMFLQDFLSHQHAWIWL 455 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.0 bits (42), Expect = 8.6 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = +1 Query: 502 KWHMKGDW 525 +W M+GDW Sbjct: 180 RWRMEGDW 187 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 508 HMKGDWVQVGGAALVEKGGNLLRHFVQTGPADHLSNL 618 H K +V +G + L K + L VQ P+D + L Sbjct: 5 HRKQRFVDIGDSLLTLKLTHALSSSVQNFPSDAIKIL 41 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,343 Number of Sequences: 336 Number of extensions: 3171 Number of successful extensions: 18 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -