BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30329 (634 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. 28 0.28 DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 24 4.6 >AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. Length = 94 Score = 27.9 bits (59), Expect = 0.28 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -2 Query: 558 LFYQSGATHLNPISLHVPL-KPMAFPFEIASRDCFHSSEVKIVKILNLLKPNC 403 L + T NP+S + P +P PF++AS S +V+ L P C Sbjct: 18 LLVSTEMTFANPLSPNSPAERPHIQPFQMASAPLVAQSRSAMVQTLTCTNPTC 70 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 23.8 bits (49), Expect = 4.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 581 KWRSKFPPFSTRAAP 537 KW+++F P TR AP Sbjct: 282 KWKTQFEPLVTRDAP 296 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 685,308 Number of Sequences: 2352 Number of extensions: 13273 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -