BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30321 (709 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 24 5.4 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 9.4 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 490 DVCKLTTQAA*LNNKKIKHFFFRLLISITE*CQLL 594 ++ K T Q N ++K FRL IT CQLL Sbjct: 94 ELLKATIQQLEEQNLEMKEQNFRLAEQITRMCQLL 128 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.0 bits (47), Expect = 9.4 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 276 NASEQLQPIRSFTLKVKRSKRALTSLDSPSFAN--NAKKQLSAE 401 +A +R+ LKV RSK L+ ++ + A+K+ SA+ Sbjct: 633 DAKNMATDVRNILLKVIRSKGGLSETEAQQYIKKMEAQKRYSAD 676 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 445,966 Number of Sequences: 2352 Number of extensions: 5435 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -