BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30320 (610 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17381| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_41410| Best HMM Match : 7tm_1 (HMM E-Value=0.00049) 28 5.1 SB_4529| Best HMM Match : 7tm_1 (HMM E-Value=1.3) 28 5.1 SB_23097| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 >SB_17381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/50 (26%), Positives = 27/50 (54%) Frame = -1 Query: 154 SVVQTRQVEVECDTTRINMHYINDVPHITASGCLGLALIGSCLNSSTNRF 5 +VV+ ++V D + + + + +PH + + +GLA+ L S +RF Sbjct: 18 NVVEQALIDVSDDESYVKVQFTPTIPHCSMATLIGLAIRVRLLRSLPDRF 67 >SB_41410| Best HMM Match : 7tm_1 (HMM E-Value=0.00049) Length = 780 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 470 VFYNMSNYFIKILSCMLFYYVLKILERKVKHSQKNKIP 583 VF NY I IL + Y + +L R VKH ++ P Sbjct: 487 VFLFSVNYLIPILVMAVLYSRIMLLIRSVKHRRRKSTP 524 >SB_4529| Best HMM Match : 7tm_1 (HMM E-Value=1.3) Length = 187 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 470 VFYNMSNYFIKILSCMLFYYVLKILERKVKHSQKNKIP 583 VF NY I IL + Y + +L R VKH ++ P Sbjct: 35 VFLFSVNYLIPILVMAVLYSRIMLLIRSVKHRRRKSTP 72 >SB_23097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 411 QWQYKTKFEMICRFQCPIKLCFTI 482 Q++YK K F CP+ LCF I Sbjct: 283 QFRYKEKAIRHILFNCPVSLCFRI 306 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,214,051 Number of Sequences: 59808 Number of extensions: 336886 Number of successful extensions: 605 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -