BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30316 (442 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_05_0058 + 8662996-8663826 29 2.2 11_06_0325 + 22376195-22377001,22377136-22377525,22377638-223777... 28 3.8 >10_05_0058 + 8662996-8663826 Length = 276 Score = 28.7 bits (61), Expect = 2.2 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Frame = +1 Query: 73 EEDVMKIQKKLTKMTSEDG-------TGQXXXXXXXXXXQTMAINLDVLTKTRIGMTVNA 231 E++V KI+ KL + EDG + Q + + + L ++IG ++ Sbjct: 76 EDEVEKIKTKLVAVVGEDGGNPRSDSSSSEAVVELLRALQAVPMTFETLEASKIGKAISG 135 Query: 232 LRKSSKDE 255 LRK S ++ Sbjct: 136 LRKHSSEQ 143 >11_06_0325 + 22376195-22377001,22377136-22377525,22377638-22377778, 22377888-22378067,22378268-22378447,22378536-22378637, 22378768-22378896,22379318-22379422,22379528-22379623 Length = 709 Score = 27.9 bits (59), Expect = 3.8 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +1 Query: 208 RIGMTVNALRKSSKDEKLYRFVKH*LKTGKSFCRHQTRLRIME 336 R+G VNA R SS+ +KL + K L K F R Q ++R E Sbjct: 384 RLGAGVNAGRASSEQKKLEKLEKEGL-IEKPFQRKQLKIRFPE 425 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,735,921 Number of Sequences: 37544 Number of extensions: 106474 Number of successful extensions: 192 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 192 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 835800280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -