BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30316 (442 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132860-14|CAB60497.1| 619|Caenorhabditis elegans Hypothetical... 28 2.6 AF016420-2|AAB65306.1| 291|Caenorhabditis elegans Serpentine re... 27 8.0 >AL132860-14|CAB60497.1| 619|Caenorhabditis elegans Hypothetical protein Y56A3A.16 protein. Length = 619 Score = 28.3 bits (60), Expect = 2.6 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 222 SHSYSCFR*DVQVDSHCLKC 163 SHS C R DV D+HC KC Sbjct: 554 SHSPKCPRRDVPRDTHCPKC 573 >AF016420-2|AAB65306.1| 291|Caenorhabditis elegans Serpentine receptor, class sx protein12 protein. Length = 291 Score = 26.6 bits (56), Expect = 8.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 293 PVFN*CFTKRYNFSSLLDFLRALTVIPILVFVKTSK 186 P+F T RY F S + L LT+I +V ++ K Sbjct: 154 PLFAFALTSRYTFKSSMLILSLLTLIIYIVMIRIFK 189 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,150,127 Number of Sequences: 27780 Number of extensions: 110978 Number of successful extensions: 236 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 236 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 756625558 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -