BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30306 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 24 3.6 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 6.3 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 6.3 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 8.4 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 8.4 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 24.2 bits (50), Expect = 3.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 446 VDVTSENPQLTLKFKTAKPNGSYSSTSAGHRP 541 V VT + + + T +P+ S SST+ HRP Sbjct: 88 VYVTHKKQAMFNEIPTVEPDISNSSTNISHRP 119 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -2 Query: 324 CLIQPSKPRSGTCSIPLLFPPKFKCLSSVCRRWANW 217 C++ P+ P++ S F PK K +V R W Sbjct: 504 CVLGPANPKTNFLSSGSSFQPKTKRDLTVQHRTGEW 539 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.4 bits (48), Expect = 6.3 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +2 Query: 53 RWKGLLAGVIRQHR 94 RW G++ G+ R+H+ Sbjct: 402 RWHGMIDGIFRRHK 415 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 79 DTCK*TLPSCISNEKKYPPSPTRYIK 2 D K L CIS K PP+P +++ Sbjct: 525 DGTKLRLGFCISRVKMAPPTPKEHLR 550 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 29 IFLLITDARWKGLLAGVIRQ 88 +F + T A W G+L G+I + Sbjct: 1799 LFQMSTSAGWDGVLDGIINE 1818 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 718,632 Number of Sequences: 2352 Number of extensions: 15229 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -