Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30305
         (642 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    23   2.1  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    23   2.1  
EF222295-1|ABN79655.1|  146|Tribolium castaneum arginine vasopre...    21   8.6  

>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 2.1
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 208 WHWHLVY 214


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 23.0 bits (47), Expect = 2.1
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 208 WHWHLVY 214


>EF222295-1|ABN79655.1|  146|Tribolium castaneum arginine
           vasopressin-like peptide protein.
          Length = 146

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/37 (24%), Positives = 16/37 (43%)
 Frame = +3

Query: 477 SFEILGNKVCCGAATTILKVDQIIMAKRAGGPKPRAP 587
           S +  G  +CCG    ++   + +  +R G    R P
Sbjct: 53  SGQCFGPSICCGPFGCLVGTPETLRCQREGFFHEREP 89


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 154,132
Number of Sequences: 336
Number of extensions: 3373
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16448590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)