Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30305
         (642 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein.    25   2.0  
L76038-1|AAC27383.1|  683|Anopheles gambiae prophenoloxidase pro...    23   8.2  
AJ459962-1|CAD31061.1|  685|Anopheles gambiae prophenoloxidase 9...    23   8.2  
AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8...    23   8.2  
AJ459960-1|CAD31059.1|  696|Anopheles gambiae prophenoloxidase 7...    23   8.2  
AJ010195-1|CAA09034.1|  687|Anopheles gambiae prophenoloxidase p...    23   8.2  
AJ010194-1|CAA09033.1|  684|Anopheles gambiae prophenoloxidase p...    23   8.2  
AJ010193-1|CAA09032.1|  684|Anopheles gambiae prophenoloxidase p...    23   8.2  
AF031626-1|AAD01936.1|  683|Anopheles gambiae prophenoloxidase p...    23   8.2  
AF004916-1|AAB94672.1|  686|Anopheles gambiae pro-phenol oxidase...    23   8.2  
AF004915-1|AAB94671.1|  688|Anopheles gambiae pro-phenol oxidase...    23   8.2  

>AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein.
          Length = 1133

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 13/42 (30%), Positives = 20/42 (47%)
 Frame = +1

Query: 274 EQYAVRKFAXALESIPRALADNSGANATEVVNKIYKAHKEGQ 399
           E   + K     ES PR+     G N   +V +I + H++GQ
Sbjct: 496 ETTRIEKQLEQFESAPRSKLAVYGTNMPALVARIRQLHQQGQ 537


>L76038-1|AAC27383.1|  683|Anopheles gambiae prophenoloxidase
           protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 208 WHWHLVY 214


>AJ459962-1|CAD31061.1|  685|Anopheles gambiae prophenoloxidase 9
           protein.
          Length = 685

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 210 WHWHLVY 216


>AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8
           protein.
          Length = 700

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 224 WHWHLVY 230


>AJ459960-1|CAD31059.1|  696|Anopheles gambiae prophenoloxidase 7
           protein.
          Length = 696

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 223 WHWHLVY 229


>AJ010195-1|CAA09034.1|  687|Anopheles gambiae prophenoloxidase
           protein.
          Length = 687

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 210 WHWHLVY 216


>AJ010194-1|CAA09033.1|  684|Anopheles gambiae prophenoloxidase
           protein.
          Length = 684

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 210 WHWHLVY 216


>AJ010193-1|CAA09032.1|  684|Anopheles gambiae prophenoloxidase
           protein.
          Length = 684

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 210 WHWHLVY 216


>AF031626-1|AAD01936.1|  683|Anopheles gambiae prophenoloxidase
           protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 208 WHWHLVY 214


>AF004916-1|AAB94672.1|  686|Anopheles gambiae pro-phenol oxidase
           subunit 2 protein.
          Length = 686

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 209 WHWHLVY 215


>AF004915-1|AAB94671.1|  688|Anopheles gambiae pro-phenol oxidase
           subunit 1 protein.
          Length = 688

 Score = 23.0 bits (47), Expect = 8.2
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 355 WHWHLSY 335
           WHWHL Y
Sbjct: 209 WHWHLVY 215


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 688,888
Number of Sequences: 2352
Number of extensions: 14065
Number of successful extensions: 40
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 38
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63141405
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)