BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30304 (697 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0301 + 2011707-2015423,2016982-2017182,2017670-2017786,201... 31 0.87 10_03_0038 - 7297210-7297248,7297361-7297429,7297524-7297731,729... 30 1.5 >02_01_0301 + 2011707-2015423,2016982-2017182,2017670-2017786, 2018030-2018122 Length = 1375 Score = 31.1 bits (67), Expect = 0.87 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -1 Query: 109 HVKLHKIERTRVKLN*MPRENSSLFHILVLKMYTKV 2 H++ +ERT + +P+ + L+H+LVLKM KV Sbjct: 624 HLRYLNLERTSISK--LPKSSCKLYHLLVLKMNKKV 657 >10_03_0038 - 7297210-7297248,7297361-7297429,7297524-7297731, 7297829-7297911,7298859-7298998,7299132-7299183 Length = 196 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +1 Query: 115 IISCNKCAVHGRLVFSYGNCDQFAGQKGLLF 207 I+ NKC + R V SY +QFA + GLLF Sbjct: 118 ILIGNKCDLSHRRVVSYQEGEQFAKEHGLLF 148 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,554,634 Number of Sequences: 37544 Number of extensions: 249418 Number of successful extensions: 356 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 356 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -