BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30303 (553 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc... 26 3.2 SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce... 25 9.8 SPCC1223.12c |meu10||GPI anchored cell surface protein |Schizosa... 25 9.8 >SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1463 Score = 26.2 bits (55), Expect = 3.2 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 404 ILQKPPKMSQILREKKNVFKNHNLIQICTSYVCTLYIFLYI 282 I +K ++S R+ ++V N + + T VC L +FL++ Sbjct: 335 IYRKSLRLSSAARQSRSVGDIVNYMSVDTQKVCDLTMFLFV 375 >SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1666 Score = 24.6 bits (51), Expect = 9.8 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -1 Query: 49 KLYWGRLNLCK 17 KL+WGRLN+ K Sbjct: 1333 KLFWGRLNMAK 1343 >SPCC1223.12c |meu10||GPI anchored cell surface protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 416 Score = 24.6 bits (51), Expect = 9.8 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -1 Query: 256 LQNLQFEK*NQEAFMTTIEKIGLVKMAGLFIEDKSVLNSVIFRYNY 119 LQ ++F+K ++A TIE L +AG+ + + VI NY Sbjct: 129 LQGIRFDKGIKKAHKLTIEDTQLSTLAGISLNTTDTM--VIVNNNY 172 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,125,613 Number of Sequences: 5004 Number of extensions: 40348 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 229961028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -