BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30298 (426 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 1.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 1.9 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 1.9 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 2.5 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.4 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.4 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.4 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.4 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.4 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 4.4 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 4.4 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 4.4 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 1.9 Identities = 12/50 (24%), Positives = 23/50 (46%) Frame = +3 Query: 33 DKSMYYYLLQQSVIEKQLFFVIYSYLYCCCQIPQIGIRKSRNIKLKFIYY 182 D S +Y ++ ++E V Y CC P + I + ++ K ++Y Sbjct: 200 DLSEFYMSVEWDILEVPA--VRNEKFYTCCDEPYLDITFNITMRRKTLFY 247 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 1.9 Identities = 12/50 (24%), Positives = 23/50 (46%) Frame = +3 Query: 33 DKSMYYYLLQQSVIEKQLFFVIYSYLYCCCQIPQIGIRKSRNIKLKFIYY 182 D S +Y ++ ++E V Y CC P + I + ++ K ++Y Sbjct: 200 DLSEFYMSVEWDILEVPA--VRNEKFYTCCDEPYLDITFNITMRRKTLFY 247 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 1.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 3 HFHNNMNNI*DKSMYY 50 H +NN NN +K +YY Sbjct: 313 HNNNNYNNYNNKKLYY 328 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 2.5 Identities = 12/50 (24%), Positives = 23/50 (46%) Frame = +3 Query: 33 DKSMYYYLLQQSVIEKQLFFVIYSYLYCCCQIPQIGIRKSRNIKLKFIYY 182 D S +Y ++ ++E V Y CC P + I + ++ K ++Y Sbjct: 196 DLSEFYTSVEWDILEVPA--VRNEKFYTCCDEPYLDITFNITMRRKTLFY 243 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +3 Query: 111 YCCCQIPQIGIRKSRNIKLKFIYY 182 Y CC P + + + I+ + +YY Sbjct: 174 YQCCPEPYVDVTFTIQIRRRTLYY 197 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +3 Query: 111 YCCCQIPQIGIRKSRNIKLKFIYY 182 Y CC P + + + I+ + +YY Sbjct: 174 YQCCPEPYVDVTFTIQIRRRTLYY 197 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +3 Query: 111 YCCCQIPQIGIRKSRNIKLKFIYY 182 Y CC P + + + I+ + +YY Sbjct: 174 YQCCPEPYVDVTFTIQIRRRTLYY 197 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +3 Query: 111 YCCCQIPQIGIRKSRNIKLKFIYY 182 Y CC P + + + I+ + +YY Sbjct: 174 YQCCPEPYVDVTFTIQIRRRTLYY 197 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +3 Query: 111 YCCCQIPQIGIRKSRNIKLKFIYY 182 Y CC P + + + I+ + +YY Sbjct: 174 YQCCPEPYVDVTFTIQIRRRTLYY 197 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.4 bits (43), Expect = 4.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +3 Query: 111 YCCCQIPQIGIRKSRNIKLKFIYY 182 Y CC P + + + I+ + +YY Sbjct: 174 YQCCPEPYVDVTFTIQIRRRTLYY 197 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 4.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +3 Query: 111 YCCCQIPQIGIRKSRNIKLKFIYY 182 Y CC P + + + I+ + +YY Sbjct: 242 YQCCPEPYVDVTFTIQIRRRTLYY 265 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 4.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +3 Query: 111 YCCCQIPQIGIRKSRNIKLKFIYY 182 Y CC P + + + I+ + +YY Sbjct: 242 YQCCPEPYVDVTFTIQIRRRTLYY 265 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,680 Number of Sequences: 438 Number of extensions: 1864 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10997463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -