BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30297 (601 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0158 - 1186903-1187013,1187108-1187197,1187504-1187590,118... 32 0.40 06_01_1096 - 8988463-8989167,8989335-8989361,8989560-8989648,898... 28 5.0 01_06_0355 + 28657833-28660665,28660762-28661126 28 6.6 04_03_0181 - 12327281-12328620,12330922-12331015,12331079-123311... 27 8.7 >06_01_0158 - 1186903-1187013,1187108-1187197,1187504-1187590, 1187668-1187839,1187917-1188647,1188789-1188861, 1189295-1189380,1189455-1189529,1189610-1189643, 1190331-1190622,1191073-1191439 Length = 705 Score = 31.9 bits (69), Expect = 0.40 Identities = 28/70 (40%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +2 Query: 23 PDGTPHRV-LRLGLAEQISLRLRLRLFTGRPSAL*HLTKNMVAYNRPTVRTLLFGTCIYA 199 P P R+ LRL L+ S RLRLRL R + K MVA TV LL T I Sbjct: 183 PPPNPRRLRLRLRLSPPASRRLRLRLRLPRAACAAARRKTMVAPKMVTVNELLGLTQIRG 242 Query: 200 LYLENVVSEI 229 Y+E +S + Sbjct: 243 -YVEKELSNL 251 >06_01_1096 - 8988463-8989167,8989335-8989361,8989560-8989648, 8989830-8990039,8990877-8991047,8991595-8991777, 8991886-8991969,8992067-8992178 Length = 526 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 239 QMPESRLRHFQDKAHIYKFRTTTFGPSVYYKQPC 138 Q PE ++ H Q H+ + R + GP +Y+Q C Sbjct: 436 QQPEQQMYHQQ---HLQQHRQYSAGPQTFYEQSC 466 >01_06_0355 + 28657833-28660665,28660762-28661126 Length = 1065 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +2 Query: 431 WTSSQPT--WC*VVSGAHRHPRRKCATHL 511 WT++ P W V G HRHP R A L Sbjct: 56 WTAAAPYCGWLGVTCGGHRHPLRVTALEL 84 >04_03_0181 - 12327281-12328620,12330922-12331015,12331079-12331183, 12331404-12332592,12333268-12333461 Length = 973 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +2 Query: 29 GTPHRVLRLGLAEQI-SLRLRLRLFTG 106 G HR++R+GL+E++ SLR RL G Sbjct: 751 GGVHRIVRVGLSERLASLRTRLAALAG 777 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,988,624 Number of Sequences: 37544 Number of extensions: 327846 Number of successful extensions: 616 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -