BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30297 (601 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071062-1|AAL48684.1| 704|Drosophila melanogaster RE14195p pro... 29 6.4 AE014297-1564|AAF54846.1| 704|Drosophila melanogaster CG6225-PA... 29 6.4 >AY071062-1|AAL48684.1| 704|Drosophila melanogaster RE14195p protein. Length = 704 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 351 ENRSNRKKSNYRTPWTVSSIEPSIELWRVAIIHAR*LT 238 E SN + + WT I+ +ELWR++ HA+ L+ Sbjct: 385 EAMSNMETRFHTEQWTEEKIKYEVELWRLSQKHAKGLS 422 >AE014297-1564|AAF54846.1| 704|Drosophila melanogaster CG6225-PA protein. Length = 704 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 351 ENRSNRKKSNYRTPWTVSSIEPSIELWRVAIIHAR*LT 238 E SN + + WT I+ +ELWR++ HA+ L+ Sbjct: 385 EAMSNMETRFHTEQWTEEKIKYEVELWRLSQKHAKGLS 422 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,869,740 Number of Sequences: 53049 Number of extensions: 554274 Number of successful extensions: 973 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 973 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2441585082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -