BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30294 (695 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0085 - 25697860-25698142,25698631-25698946,25700481-257005... 29 3.5 06_03_1303 + 29180837-29181205,29181289-29181306,29181337-291816... 28 6.2 >02_05_0085 - 25697860-25698142,25698631-25698946,25700481-25700518, 25700955-25701036,25701815-25702016 Length = 306 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -2 Query: 406 NSEYLMFDCVLQSH*PVLHRPHILKYIWQYFVPQQASLVLVDQW 275 N + ++C + P++ P + K WQ V + VLV+ W Sbjct: 89 NKPSIAWNCSFKEQTPIMKVPDVTKSTWQSLVVESELPVLVEFW 132 >06_03_1303 + 29180837-29181205,29181289-29181306,29181337-29181622, 29185008-29186284,29186499-29187005 Length = 818 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 432 DWLQFCYAHWCRRSRWRTGFSKSWIVLEDFRSIP 533 DWL +C +R RW ++S +V R +P Sbjct: 376 DWLSWCSVMLVKRRRWSASMAQSNLVTFCLRKLP 409 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,771,088 Number of Sequences: 37544 Number of extensions: 384062 Number of successful extensions: 708 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -