BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30294 (695 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 2.1 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 3.7 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 8.5 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 8.5 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.4 bits (48), Expect = 2.1 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = -3 Query: 315 LSLNRHHWYW 286 + +N HHW+W Sbjct: 203 IGINLHHWHW 212 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -1 Query: 317 FCPSTGIIGIG*PVDNQ*LRSYDLRNYRHH 228 F PST ++ + P +++ L Y ++ HH Sbjct: 49 FSPSTHLMDLSSPPEHRDLPIYQSHHHLHH 78 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 153 WAFSLPSMYNKEYPSHN 103 W F++P+MY K+ +N Sbjct: 661 WNFTIPNMYFKDVFIYN 677 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 153 WAFSLPSMYNKEYPSHN 103 W F++P+MY K+ +N Sbjct: 661 WNFTIPNMYFKDVFIYN 677 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,620 Number of Sequences: 438 Number of extensions: 4513 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -