BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30293 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation facto... 110 9e-27 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 25 0.79 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 3.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.3 >AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation factor 1-alpha protein. Length = 56 Score = 110 bits (265), Expect = 9e-27 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = +1 Query: 289 LQDVYKIGGIGTVPVGRVETGVLKPGTIVVFAPANIXTEVKSVEMHHEALQEAVPG 456 LQDVYKIGGIGTVPVGRVETGVLKPG +VVFAPANI TEVKSVEMHHEAL EAVPG Sbjct: 1 LQDVYKIGGIGTVPVGRVETGVLKPGMVVVFAPANITTEVKSVEMHHEALPEAVPG 56 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -2 Query: 357 QHTSFN-SADGHGTNTTDFVYVLQ 289 ++ SFN +A+GHG NT+ Y Q Sbjct: 280 EYNSFNWTANGHGHNTSSHNYYAQ 303 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 393 VGGGKDNNGTWFQHTSF 343 V GG +NNGT H+ F Sbjct: 185 VSGGNNNNGTPGGHSGF 201 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -3 Query: 143 CCLRAIQKWARKRQQLGCSQSS*CMRIL 60 CC A+ RQ + S+ C+R + Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -3 Query: 143 CCLRAIQKWARKRQQLGCSQSS*CMRIL 60 CC A+ RQ + S+ C+R + Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIRYM 534 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,287 Number of Sequences: 336 Number of extensions: 4137 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -