BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30292 (627 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 27 0.37 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 24 3.4 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 24 4.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 7.9 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 27.5 bits (58), Expect = 0.37 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 94 ERQDPRRVVPRLG-PTAVRFASVRQTVSHNRTCVV 195 +++ R+ V R P A+R AS QTVS++ CVV Sbjct: 796 DKETHRKSVQRAHRPGALRVASAFQTVSYDAACVV 830 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 24.2 bits (50), Expect = 3.4 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = +1 Query: 376 RPTRIRLSVKAQRRSKRRRPPDTSRCHSPAPDN*TSRPSSLGTAKVAYRVPK--GQLQFG 549 RP R + + S+RR S+ H DN + T K++ R K QL Sbjct: 509 RPAREKTEPASGASSRRRSKSFLSKSHRNGKDNAAFERGGITTVKMSGREGKETHQLSVI 568 Query: 550 GRERGHE 570 G E+ ++ Sbjct: 569 GSEQSYQ 575 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.8 bits (49), Expect = 4.5 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Frame = +1 Query: 364 RRTCRPTRIRLSVKAQRRSKRRRPPDTSRCHSPAPDN*TSRPSSLGTAKVAYRVPKGQLQ 543 RRT PTR+ + A +RRR +R P + P++ T V +R + + Sbjct: 474 RRTIPPTRVAAAAAAPEGRRRRRAIARARRRRCRPRARRNPPAT--TRPVRHRPTRRKST 531 Query: 544 FGGR--ERGHEQR 576 G+ ++G+++R Sbjct: 532 KRGKKDDKGYDRR 544 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 614 PSGRSRDNGTCTQRCSCPRSR-PPNWSC 534 P +DNG C ++ CP+ + P N C Sbjct: 266 PEHLLKDNGACVRK--CPKGKMPQNSEC 291 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,727 Number of Sequences: 2352 Number of extensions: 14530 Number of successful extensions: 34 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -