BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30290 (685 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 30 0.015 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 25 0.44 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 30.3 bits (65), Expect = 0.015 Identities = 18/75 (24%), Positives = 32/75 (42%), Gaps = 4/75 (5%) Frame = +2 Query: 11 DDYGNYTCGLKNQTG--HIKAWM-VTGNVHAKMTKDANVVE-GQNIKITCKLIGKPYSEV 178 +D G Y C + N G ++ + VT + AK+ ++ G+ TC G P + Sbjct: 300 EDSGKYLCVVNNSVGGESVETVLTVTAPLKAKIEPQVQTIDFGRPATFTCNFEGNPIKTI 359 Query: 179 TWKYKKDELDNGTDV 223 +W +D+ V Sbjct: 360 SWLKDGHPIDHNEAV 374 Score = 26.2 bits (55), Expect = 0.25 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 5/61 (8%) Frame = +2 Query: 20 GNYTCGLKNQTGHIKAWMVTG--NVHAKMT---KDANVVEGQNIKITCKLIGKPYSEVTW 184 GNYTC L + + + + + NV + D +G + + CK G P VTW Sbjct: 674 GNYTC-LASNSASVTTYTTSLFINVPPRWILEPTDKAFAQGSDAAVECKADGFPRPVVTW 732 Query: 185 K 187 K Sbjct: 733 K 733 Score = 25.8 bits (54), Expect = 0.33 Identities = 18/75 (24%), Positives = 30/75 (40%), Gaps = 7/75 (9%) Frame = +2 Query: 8 EDDYGNYTCGLKNQTGHIKAWM---VTGNVHAKMTKDA----NVVEGQNIKITCKLIGKP 166 ++D G Y C ++N +A + G + A V G ++ + C G P Sbjct: 382 KEDKGMYQCFIRNDQESAEATAELKLGGRFEPPQIRHAFNEETVQPGNSVFLKCIASGNP 441 Query: 167 YSEVTWKYKKDELDN 211 E+TW+ L N Sbjct: 442 TPEITWELYGRRLSN 456 Score = 25.4 bits (53), Expect = 0.44 Identities = 15/62 (24%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +2 Query: 11 DDYGNYTCGLKNQTG---HIKAWMVTGNVHAKMTKDANVVEGQNIKITCKLIGKPYSEVT 181 +D G Y C ++ G H V G + + +V G + + C G P V Sbjct: 484 NDGGLYRCVASSKVGSADHSARINVYGLPFVRSMEKQAIVAGGTLIVHCPFAGHPVDSVV 543 Query: 182 WK 187 W+ Sbjct: 544 WE 545 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 25.4 bits (53), Expect = 0.44 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -2 Query: 231 TALTSVPLSNSSFLYFHVTSEYGLPINLQVILMFCPSTTLASLVILAC 88 +AL SV + S L H T E+ LP+ L + CP L + L C Sbjct: 345 SALASVIMGLSPILGRHNTIEHLLPLFLTQLKDECPEVRLNIISNLDC 392 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 434 EHHDLRADAEEGPERVVHALDPE 366 +HH L A EEG + + D E Sbjct: 1174 DHHHLGAVTEEGGDESANETDSE 1196 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 434 EHHDLRADAEEGPERVVHALDPE 366 +HH L A EEG + + D E Sbjct: 1174 DHHHLGAVTEEGGDESANETDSE 1196 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 434 EHHDLRADAEEGPERVVHALDPE 366 +HH L A EEG + + D E Sbjct: 1174 DHHHLGAVTEEGGDESANETDSE 1196 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 434 EHHDLRADAEEGPERVVHALDPE 366 +HH L A EEG + + D E Sbjct: 1174 DHHHLGAVTEEGGDESANETDSE 1196 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,125 Number of Sequences: 336 Number of extensions: 1801 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -