BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30287 (485 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 127 6e-30 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 4e-29 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 83 1e-16 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 74 5e-14 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 74 5e-14 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 68 5e-12 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 58 3e-09 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 58 5e-09 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 52 2e-07 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 47 9e-06 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 46 1e-05 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 46 2e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 42 3e-04 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 41 5e-04 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 37 0.008 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.018 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 36 0.023 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.071 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 33 0.094 SB_33720| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 31 0.50 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_44173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_30467| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) 28 4.7 SB_44917| Best HMM Match : DUF156 (HMM E-Value=3) 27 8.2 SB_57823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_43084| Best HMM Match : ig (HMM E-Value=9.7e-23) 27 8.2 SB_10225| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 127 bits (306), Expect = 6e-30 Identities = 59/76 (77%), Positives = 69/76 (90%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDTSIRECQALILXPTRELAQQIQKVVIALGDHLNAKC 435 VIAQAQSGTGKTATFSIS+LQ IDT +RE QAL+L PTRELA QIQKVV+ALGD+++ +C Sbjct: 37 VIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGDYMSVQC 96 Query: 436 HACIGGTNVREDIRQL 483 HACIGGTN+ EDIR+L Sbjct: 97 HACIGGTNIGEDIRKL 112 Score = 35.5 bits (78), Expect = 0.023 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +2 Query: 194 GFEKPSAIQQRXIMPCIQGR 253 GFEKPSAIQQR I P ++GR Sbjct: 16 GFEKPSAIQQRAIKPILKGR 35 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 124 bits (299), Expect = 4e-29 Identities = 62/93 (66%), Positives = 76/93 (81%), Gaps = 6/93 (6%) Frame = +1 Query: 223 TRNNALHPRTRVIAQAQSGTGKTATFSISILQQIDTSIRE------CQALILXPTRELAQ 384 T+N+ + VIAQAQSGTGKTATF+ISILQ+IDT+ ++ CQAL+L PTRELAQ Sbjct: 114 TKNHYVLSARDVIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQ 173 Query: 385 QIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 483 QIQKVV+ALGD+++ KCHACIGGTNVRED +L Sbjct: 174 QIQKVVLALGDYMHVKCHACIGGTNVREDRMKL 206 Score = 84.2 bits (199), Expect = 5e-17 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = +2 Query: 104 GTLDTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRXIMPCIQ 247 G ++WD+VVE+FDDMNLKE LLRGIYAYGFEKPSAIQQR I PC Q Sbjct: 52 GKRQSNWDEVVESFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQ 99 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 83.0 bits (196), Expect = 1e-16 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = +1 Query: 334 IRECQALILXPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 483 +RE QAL+L PTRELA QIQKVV+ALGD+++ +CHACIGGTN+ EDIR+L Sbjct: 1 LREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKL 50 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 74.1 bits (174), Expect = 5e-14 Identities = 33/76 (43%), Positives = 54/76 (71%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDTSIRECQALILXPTRELAQQIQKVVIALGDHLNAKC 435 ++A+A++GTGKTA + + +L++ DT+ QAL+L PTRELA Q ++ I LG H+ A+ Sbjct: 87 ILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQV 146 Query: 436 HACIGGTNVREDIRQL 483 GGT++++DI +L Sbjct: 147 MVTTGGTSLKDDILRL 162 Score = 41.1 bits (92), Expect = 5e-04 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 143 FDDMNLKEELLRGIYAYGFEKPSAIQQRXIMPCIQGR 253 F+D LK ELL GI+ GF+KPS IQ+ I + GR Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGR 85 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 74.1 bits (174), Expect = 5e-14 Identities = 33/76 (43%), Positives = 54/76 (71%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDTSIRECQALILXPTRELAQQIQKVVIALGDHLNAKC 435 ++A+A++GTGKTA + + +L++ DT+ QAL+L PTRELA Q ++ I LG H+ A+ Sbjct: 87 ILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQV 146 Query: 436 HACIGGTNVREDIRQL 483 GGT++++DI +L Sbjct: 147 MVTTGGTSLKDDILRL 162 Score = 41.1 bits (92), Expect = 5e-04 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 143 FDDMNLKEELLRGIYAYGFEKPSAIQQRXIMPCIQGR 253 F+D LK ELL GI+ GF+KPS IQ+ I + GR Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGR 85 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 67.7 bits (158), Expect = 5e-12 Identities = 34/77 (44%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDTSIRECQALILXPTRELAQQIQKVVIALGDHLNA-K 432 +IAQA+SGTGKT FS+ L+ + T Q +IL PTRE+A Q++ V+ A+G H + Sbjct: 53 LIAQAKSGTGKTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIGCHYDGLA 112 Query: 433 CHACIGGTNVREDIRQL 483 C IGG ++ ED + L Sbjct: 113 CKVFIGGISLEEDKKAL 129 Score = 30.7 bits (66), Expect = 0.67 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 143 FDDMNLKEELLRGIYAYGFEKPSAIQQRXI 232 F + L LLRG+ GFEKPS IQ + I Sbjct: 15 FHSLLLSPTLLRGLNEAGFEKPSPIQLKAI 44 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 58.4 bits (135), Expect = 3e-09 Identities = 30/69 (43%), Positives = 43/69 (62%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDTSIRECQALILXPTRELAQQIQKVVIALGDHLNAKC 435 VI A++G+GKT F++ ILQ + + + ALIL PTRELA QI + ALG + KC Sbjct: 4 VIGLAETGSGKTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEALGSGIGVKC 63 Query: 436 HACIGGTNV 462 +GG ++ Sbjct: 64 AVIVGGIDM 72 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 57.6 bits (133), Expect = 5e-09 Identities = 28/59 (47%), Positives = 39/59 (66%) Frame = +1 Query: 244 PRTRVIAQAQSGTGKTATFSISILQQIDTSIRECQALILXPTRELAQQIQKVVIALGDH 420 P +IAQ+QSGTGKTA F +++L ++D + Q + L PT ELA+Q KV A+G H Sbjct: 141 PPVNMIAQSQSGTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMGKH 199 Score = 33.5 bits (73), Expect = 0.094 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 137 ETFDDMNLKEELLRGIYAYGFEKPSAIQQ 223 ++F+++ L L RG+Y GF KPS IQ+ Sbjct: 103 KSFEELPLSANLRRGVYDMGFNKPSKIQE 131 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 55.2 bits (127), Expect = 3e-08 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDTSIREC--QALILXPTRELAQQIQKVVIALGDHLNA 429 V+A A++G+GKTA F I + +++ T + +ALIL PTRELA Q QK + LG Sbjct: 321 VVAMARTGSGKTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQTQKFIKELGRFTGL 380 Query: 430 KCHACIGGTNV 462 K +GG +V Sbjct: 381 KSSVILGGDSV 391 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 52.4 bits (120), Expect = 2e-07 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDTSIRECQALILXPTRELAQQIQKVVIALGDHL-NAK 432 +I QA+SG GKTA F ++ LQQ++ + L++ TRELA QI K ++ N K Sbjct: 87 IICQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMSNIK 146 Query: 433 CHACIGGTNVREDIRQL 483 GG N+++D + L Sbjct: 147 IAVFFGGINIKKDQQTL 163 Score = 33.9 bits (74), Expect = 0.071 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +2 Query: 143 FDDMNLKEELLRGIYAYGFEKPSAIQQRXIMPCIQG 250 F D LK ELLR I GFE PS +Q I I G Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG 84 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 52.4 bits (120), Expect = 2e-07 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDTSIRECQALILXPTRELAQQIQKVVIALGDHL-NAK 432 +I QA+SG GKTA F ++ LQQ++ + L++ TRELA QI K ++ N K Sbjct: 87 IICQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMSNIK 146 Query: 433 CHACIGGTNVREDIRQL 483 GG N+++D + L Sbjct: 147 IAVFFGGINIKKDQQTL 163 Score = 33.9 bits (74), Expect = 0.071 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +2 Query: 143 FDDMNLKEELLRGIYAYGFEKPSAIQQRXIMPCIQG 250 F D LK ELLR I GFE PS +Q I I G Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG 84 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 48.0 bits (109), Expect = 4e-06 Identities = 30/81 (37%), Positives = 42/81 (51%), Gaps = 5/81 (6%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISIL-----QQIDTSIRECQALILXPTRELAQQIQKVVIALGDH 420 ++A AQ+G+GKTA + + +L Q ++ R AL + PTRELA+QI DH Sbjct: 519 LMACAQTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDH 578 Query: 421 LNAKCHACIGGTNVREDIRQL 483 K C GG +V QL Sbjct: 579 TPIKVCVCYGGVSVPYQASQL 599 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 46.8 bits (106), Expect = 9e-06 Identities = 26/80 (32%), Positives = 48/80 (60%), Gaps = 4/80 (5%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQ----QIDTSIRECQALILXPTRELAQQIQKVVIALGDHL 423 V+ A++G+GKT F I I++ Q TS+ AL++ PTRELA Q +V++ +G+ Sbjct: 90 VLGAAKTGSGKTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVKIGNKH 149 Query: 424 NAKCHACIGGTNVREDIRQL 483 + IGG +++ + +++ Sbjct: 150 DLSAGLIIGGKDLKNEQKRI 169 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 46.4 bits (105), Expect = 1e-05 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 9/77 (11%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQI---------DTSIRECQALILXPTRELAQQIQKVVIA 408 +I A++G+GKTA F+I +L I + + + ALIL PTRELAQQI++ ++ Sbjct: 141 IIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILK 200 Query: 409 LGDHLNAKCHACIGGTN 459 G L + + IGG + Sbjct: 201 FGRPLGIRTVSVIGGAD 217 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 46.0 bits (104), Expect = 2e-05 Identities = 27/75 (36%), Positives = 41/75 (54%) Frame = +1 Query: 259 IAQAQSGTGKTATFSISILQQIDTSIRECQALILXPTRELAQQIQKVVIALGDHLNAKCH 438 I A++G+GKTA F++ ILQ++ A++L PTRELA QI LG + K Sbjct: 48 IGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQIADQFKVLGRPIGLKEA 107 Query: 439 ACIGGTNVREDIRQL 483 +GG ++ + L Sbjct: 108 VIVGGLDMMKQALSL 122 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 140 TFDDMNLKEELLRGIYAYGFEKPSAIQQRXIMPCIQGR 253 +F + L + L+ A G +KP+ IQ + P +QGR Sbjct: 8 SFAGLGLNKWLVSQCVAMGIKKPTEIQLNCVPPILQGR 45 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 42.3 bits (95), Expect = 2e-04 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 9/85 (10%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQI------DTSIREC---QALILXPTRELAQQIQKVVIA 408 V+A AQ+G+GKTA F + ++ + +S E QA+ + PTRELA QI Sbjct: 751 VMACAQTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARK 810 Query: 409 LGDHLNAKCHACIGGTNVREDIRQL 483 + C GG +V +RQL Sbjct: 811 FAHGTMLRPVVCYGGVSVSHQLRQL 835 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 41.9 bits (94), Expect = 3e-04 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 6/78 (7%) Frame = +1 Query: 220 ATRNNALHPRTRVIAQAQSGTGKTATFSISILQQI-DTSI-----RECQALILXPTRELA 381 A+ N ++ VI QA++GTGKT +F++ +++++ D + R + L++ PTRELA Sbjct: 101 ASTFNYIYDGEDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELA 160 Query: 382 QQIQKVVIALGDHLNAKC 435 +Q+ L +L C Sbjct: 161 KQVGNEFENLKSNLEVYC 178 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 41.1 bits (92), Expect = 5e-04 Identities = 19/44 (43%), Positives = 26/44 (59%) Frame = +1 Query: 352 LILXPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 483 L+L PTRELAQQ+Q+V ++G H + GG IR+L Sbjct: 136 LVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIREL 179 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 38.7 bits (86), Expect = 0.003 Identities = 28/81 (34%), Positives = 38/81 (46%), Gaps = 5/81 (6%) Frame = +1 Query: 256 VIAQAQSGTGKTATFS----ISILQQIDTSIRECQ-ALILXPTRELAQQIQKVVIALGDH 420 +I A++G+GKTA F + I+ Q + + + LI PTREL QQI G Sbjct: 557 IIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKA 616 Query: 421 LNAKCHACIGGTNVREDIRQL 483 N A GG N E + L Sbjct: 617 YNIHVVAVFGGGNKYEQSKAL 637 >SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +1 Query: 421 LNAKCHACIGGTNVREDIRQL 483 ++ KCHACIGGTNVRED +L Sbjct: 1 MHVKCHACIGGTNVREDRMKL 21 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 37.1 bits (82), Expect = 0.008 Identities = 21/47 (44%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQI---DTSIRECQALILXPTRELAQQ 387 V A A +GTGKTA F + IL+++ T + L++ PTRELA Q Sbjct: 50 VCACAATGTGKTAAFMLPILERLLYRPTQSPAIRVLVITPTRELAIQ 96 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 37.1 bits (82), Expect = 0.008 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 19/85 (22%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDT--------------SIRECQ-----ALILXPTREL 378 +I A++G+GKT F I I+Q I+ S E Q ALI+ PTREL Sbjct: 171 IIGAAETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMAPTREL 230 Query: 379 AQQIQKVVIALGDHLNAKCHACIGG 453 A Q++ ++ + + K A +GG Sbjct: 231 ALQVKDHLVKAAKYTSVKVAAIVGG 255 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 35.9 bits (79), Expect = 0.018 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +1 Query: 337 RECQALILXPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 483 R+ A+++ PTRELA QI + N +C GGT + E I +L Sbjct: 143 RDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAEL 191 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 35.5 bits (78), Expect = 0.023 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 9/78 (11%) Frame = +1 Query: 247 RTRVIAQAQSGTGKTATFSISILQQIDTS---------IRECQALILXPTRELAQQIQKV 399 R VI AQ+G+GKT + ++ ++ ++ +A I+ P RELA QI K Sbjct: 415 RHHVICAAQTGSGKTLAYLAPLVHRLREDEERHGILARLKRPRACIVVPARELATQILKT 474 Query: 400 VIALGDHLNAKCHACIGG 453 +L H + IGG Sbjct: 475 AKSLCHHARFRSVGLIGG 492 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 33.9 bits (74), Expect = 0.071 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 4/80 (5%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQ---QIDTSIRE-CQALILXPTRELAQQIQKVVIALGDHL 423 ++ A++G+GKT F + +++ ++ R +I+ PTREL+ Q V L H Sbjct: 612 LLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARDLLKHH 671 Query: 424 NAKCHACIGGTNVREDIRQL 483 N +GG N + + +L Sbjct: 672 NFTYGIIMGGVNRKAEAERL 691 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 33.5 bits (73), Expect = 0.094 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 5/50 (10%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDTSIRECQ-----ALILXPTRELAQQI 390 +I A++G+GKT +S+ + + T ALIL PTREL QQ+ Sbjct: 112 IIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +2 Query: 119 DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRXIMPCIQGR-VLSLKPSQELEKLL 295 D + +E+F D+NL EL + F+ P+ IQ + + + GR ++ L + + L Sbjct: 66 DCPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLA 125 Query: 296 LSL 304 SL Sbjct: 126 YSL 128 >SB_33720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 32.7 bits (71), Expect = 0.16 Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = +2 Query: 14 ERRSEDWPEDSKNGPSKDQGSYD---GPPGMDPGTLDTDWDQVVETFDDMNLKEELLRGI 184 E+ +E+ E +K + D+G GPPG GT D VVE DD K E G Sbjct: 19 EKTAEEMRELAKKAEACDRGVRAILLGPPGSGKGTQLVSDDLVVELIDDNLTKPECQNGW 78 Query: 185 YAYGFEKPSA 214 GF + A Sbjct: 79 LLDGFPRTVA 88 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 31.1 bits (67), Expect = 0.50 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQIDTSIRECQALILXPTRELA-QQIQKVVIALGD 417 ++ ++++GTGK+ F +L + R +I+ PTRELA Q + +V LGD Sbjct: 200 LLIKSETGTGKSLVF---LLPSVQDPGRGYGTIIVVPTRELASQMLYEVSRLLGD 251 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = +2 Query: 143 FDDMNLKEELLRGIYAYGFEKPSAIQQRXIMPCIQGR 253 F+D++L E LL + G++KP+ +Q+ I P ++G+ Sbjct: 877 FEDVDLGEILLHNVGLAGYKKPTPVQKYAI-PIVKGK 912 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 256 VIAQAQSGTGKTATFSISILQQI 324 ++A AQ+G+GKTA F I IL +I Sbjct: 915 LMACAQTGSGKTAAFLIPILSRI 937 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 53 GPSKDQG-SYDGPPGMDPGTLDTDWDQVVETFDDMNLKEELLRG 181 GP +QG S GPPG PG T W+ + N E LRG Sbjct: 3363 GPKGEQGRSISGPPG-PPGAPGTSWNDSIVNGGLSNSLLESLRG 3405 >SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 512 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 319 QIDTSIRECQALILXPTRELAQQIQKVVIALGDHLNAKCHACI 447 Q D++++E IL ELA++IQK++ LN K AC+ Sbjct: 58 QGDSTLKEPVQKILIIGLELAKEIQKLIDEASSGLNIKHAACL 100 >SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 435 AFSIQVITKSYHHLLNLLGQLSCGXQDQSLTFTNACID 322 A ++Q +TK+Y HL+N+ G +++ T C D Sbjct: 201 AHALQTLTKAYRHLMNVTGNRD---KEEKANATEQCAD 235 >SB_44173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 4.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 38 EDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEE 169 +D N + D G+ D D GT+D D D V+ DD N + Sbjct: 71 DDDGNIDNDDDGNIDND---DDGTIDNDDDGYVDNVDDDNFDND 111 >SB_30467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 4.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 38 EDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMNLKEE 169 +D N + D G+ D D GT+D D D V+ DD N + Sbjct: 54 DDDGNIDNDDDGNIDND---DDGTIDNDDDGYVDNVDDDNFDND 94 >SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) Length = 829 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 Query: 190 GVYASQQFFFEVHVIEGFDNLIPVGVKC 107 GVY F H + GF N IP +C Sbjct: 742 GVYLESNVFQNGHALVGFQNTIPASQEC 769 >SB_44917| Best HMM Match : DUF156 (HMM E-Value=3) Length = 1198 Score = 27.1 bits (57), Expect = 8.2 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +1 Query: 133 CRNLR*HEPQRRIVERHIRLWF*KTFCNPATRNNALHPRTRVIAQAQSGTGKTATFSISI 312 CR + E + + R L F T C+P +H R+ V Q Q+ + +T S S+ Sbjct: 825 CRVIGETEEYKDLKARQSLLAFALTHCSPDAIEELIHSRSLVETQKQTDEPEGSTVSRSL 884 Query: 313 L 315 + Sbjct: 885 M 885 >SB_57823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 614 Score = 27.1 bits (57), Expect = 8.2 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 7/37 (18%) Frame = +2 Query: 50 NGPSKDQGSYDGPPGMDPGTLD-------TDWDQVVE 139 NGP+ D YD PP P T D T+WD ++ Sbjct: 340 NGPTSDNTDYDSPPRATP-TYDAPTRSTRTNWDPTID 375 >SB_43084| Best HMM Match : ig (HMM E-Value=9.7e-23) Length = 960 Score = 27.1 bits (57), Expect = 8.2 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +3 Query: 189 PMVLKNLLQSSNAX*CLASKDACYRSSPVRNWKNCYFLYI 308 PM++ + S + C+A+ +A +++ +W N F YI Sbjct: 431 PMLVLSKKNDSGSYRCIATNEAVCKNTSTSDWINVTFKYI 470 >SB_10225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 8.2 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +1 Query: 250 TRVIAQAQSGTGKTATFSISILQQID-TSIRECQALILXPTRELAQQIQKVVIALGDHLN 426 +++IA+A+S + FS S+ + + +S + +AL L + + ++ ALGD + Sbjct: 3 SKIIARAKSCSSDKEMFSDSVEKHVCVSSFKYFRALHLCGSSQTSK-------ALGDTTH 55 Query: 427 AKCHA 441 AKCHA Sbjct: 56 AKCHA 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,105,534 Number of Sequences: 59808 Number of extensions: 343535 Number of successful extensions: 1699 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 1604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1690 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1026164244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -