BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30286 (515 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC342.01c |alg6|SPBC3F6.06c|glucosyltransferase Alg6|Schizosac... 26 3.8 SPAC1486.02c |ucp14||UBA domain protein Ucp14|Schizosaccharomyce... 25 8.9 >SPBC342.01c |alg6|SPBC3F6.06c|glucosyltransferase Alg6|Schizosaccharomyces pombe|chr 2|||Manual Length = 506 Score = 25.8 bits (54), Expect = 3.8 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -2 Query: 349 CIMIN*TGITVEYVFKNNYYSFTLYYCFV*LFK 251 C+M+ + + KN Y + T ++C FK Sbjct: 188 CVMLGLVMYAIANLLKNQYVAATFFFCLALTFK 220 >SPAC1486.02c |ucp14||UBA domain protein Ucp14|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 24.6 bits (51), Expect = 8.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 329 GLIYHNTYFPGRNWVKSFSNT*KPLITVSGFFLRNP 436 G+ YH + PG +W KP ++ + F+R P Sbjct: 185 GMFYHLSLLPGTSWRLPIRFV-KPALSPTHVFIRPP 219 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,828,371 Number of Sequences: 5004 Number of extensions: 32704 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -