BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30281 (636 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.4 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.6 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +3 Query: 225 FSSLVDMQARGCTCWNSAQRSAFSYWTFCFQFV 323 F+S D+ + G CW YW + Q V Sbjct: 815 FTSASDVWSMGIVCWEVMSYGERPYWNWSNQDV 847 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.6 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +2 Query: 344 SAM*SAPPPEFHSATSNCQNTSMMITSRRIRSASNVQSNAKRVMTSLP 487 +A+ S PPP F + + + S ++++ R + + +A M +P Sbjct: 374 TALMSQPPPNFGVSQVSPVSMSALVSAVRSPAGGQLPPSAGAPMPPIP 421 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,618 Number of Sequences: 438 Number of extensions: 3740 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -