BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30267 (729 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0441 - 3305319-3305894 29 3.8 02_03_0205 - 16411707-16412759,16413077-16413256,16413960-164144... 29 5.0 >01_01_0441 - 3305319-3305894 Length = 191 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 160 HEEGKYWHDYNYHAVFYYRSKHLKIWQLICAP 65 H+EGK W D++Y+ V Y + L IC P Sbjct: 159 HDEGKRWADHDYYNVM-YATGPLAFRPAICPP 189 >02_03_0205 - 16411707-16412759,16413077-16413256,16413960-16414498, 16414798-16414825 Length = 599 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 644 NQVDKSFHEAVDDLNQQDFIAVS 712 + + K HEA+DDL DF+A S Sbjct: 407 SDLSKMVHEAIDDLEMPDFVAKS 429 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,573,634 Number of Sequences: 37544 Number of extensions: 333122 Number of successful extensions: 762 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -