BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30265 (583 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 3.8 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 22 5.1 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 6.7 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 8.9 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 8.9 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 8.9 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/28 (32%), Positives = 10/28 (35%) Frame = -3 Query: 536 CNTLCDCXNILKCSLTCTCAQKPDCLVD 453 C LC C + C TC C D Sbjct: 743 CFALCHCCDFDACDCEMTCPAGCKCYND 770 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.8 bits (44), Expect = 5.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 118 ETYQRLAHRSNSICRKA*FQECRRLVVKTWFP 23 + Y+RL H N I ++ F RL T+ P Sbjct: 240 QVYRRLVHAVNEIEKRLLFSHNDRLGFLTFCP 271 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 239 EFVRRSTIGHWALRKRLCAYLPAE 168 EF R T AL K+LC PAE Sbjct: 585 EFPRSITRNATALIKKLCRDNPAE 608 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.0 bits (42), Expect = 8.9 Identities = 5/16 (31%), Positives = 11/16 (68%) Frame = -3 Query: 248 IIREFVRRSTIGHWAL 201 +++E +R+ GHW + Sbjct: 66 LMKERIRQKAAGHWVI 81 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.0 bits (42), Expect = 8.9 Identities = 5/16 (31%), Positives = 11/16 (68%) Frame = -3 Query: 248 IIREFVRRSTIGHWAL 201 +++E +R+ GHW + Sbjct: 66 LMKERIRQKAAGHWVI 81 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.0 bits (42), Expect = 8.9 Identities = 5/16 (31%), Positives = 11/16 (68%) Frame = -3 Query: 248 IIREFVRRSTIGHWAL 201 +++E +R+ GHW + Sbjct: 66 LMKERIRQKAAGHWVI 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,446 Number of Sequences: 438 Number of extensions: 3122 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -