BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30264 (749 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15860.2 68418.m01856 expressed protein 39 0.004 At5g15860.1 68418.m01855 expressed protein 39 0.004 At3g02410.1 68416.m00228 hypothetical protein weak similarity to... 35 0.066 At4g14570.1 68417.m02243 acylaminoacyl-peptidase-related similar... 33 0.15 At2g23200.1 68415.m02771 protein kinase family protein contains ... 32 0.47 At1g26120.1 68414.m03188 esterase-related contains similaity to ... 32 0.47 >At5g15860.2 68418.m01856 expressed protein Length = 299 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/37 (43%), Positives = 26/37 (70%) Frame = +3 Query: 9 DNIAKFGGDPNKITILGESSGSGAVTHHLLSPMSKDL 119 +NI+ FGGDPN+I ++G+S+G+ LL +K+L Sbjct: 217 NNISAFGGDPNRIYLMGQSAGAHIAACALLEQATKEL 253 >At5g15860.1 68418.m01855 expressed protein Length = 427 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/37 (43%), Positives = 26/37 (70%) Frame = +3 Query: 9 DNIAKFGGDPNKITILGESSGSGAVTHHLLSPMSKDL 119 +NI+ FGGDPN+I ++G+S+G+ LL +K+L Sbjct: 217 NNISAFGGDPNRIYLMGQSAGAHIAACALLEQATKEL 253 >At3g02410.1 68416.m00228 hypothetical protein weak similarity to kynurenine formamidase [Mus musculus] GI:21552719 Length = 422 Score = 34.7 bits (76), Expect = 0.066 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = +3 Query: 9 DNIAKFGGDPNKITILGESSGS 74 +NI+ FGGDPN+I ++G+S+G+ Sbjct: 212 NNISAFGGDPNRIYLMGQSAGA 233 >At4g14570.1 68417.m02243 acylaminoacyl-peptidase-related similar to Acylamino-acid-releasing enzyme (EC 3.4.19.1) (Acyl-peptide hydrolase) (APH) (Acylaminoacyl-peptidase) (Swiss-Prot:P13676) [Rattus norvegicus]; annotated with nonconsensus TT and CT acceptor splice sites. Length = 764 Score = 33.5 bits (73), Expect = 0.15 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = +3 Query: 9 DNIAKFG-GDPNKITILGESSGSGAVTHHLLSPMSKDLFHGAIAQSGVC 152 D+ + G DP++IT+LG S G G +T HL+ + D F A A++ VC Sbjct: 599 DHAIEMGIADPSRITVLGGSHG-GFLTTHLIG-QAPDKFVAAAARNPVC 645 >At2g23200.1 68415.m02771 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 834 Score = 31.9 bits (69), Expect = 0.47 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = -1 Query: 503 SFLSNISFSNKRLRQTYDQSSRAP--YSLYQILKHPMDF*LKMLQHFGISFL 354 S +++SF+NK DQSS AP Y +I +HP + K L G+ F+ Sbjct: 62 SSTNSVSFTNKGTEVINDQSSVAPEIYRTVRIFRHPSSYKFK-LDSLGLHFV 112 >At1g26120.1 68414.m03188 esterase-related contains similaity to esterase 6 GI:606998 from [Drosophila simulans] and esterase GI:12584120 from [Sphingomonas elodea] Length = 476 Score = 31.9 bits (69), Expect = 0.47 Identities = 12/40 (30%), Positives = 27/40 (67%) Frame = +3 Query: 9 DNIAKFGGDPNKITILGESSGSGAVTHHLLSPMSKDLFHG 128 ++IA++GGDP++I ++G+S+G+ ++ + K+ G Sbjct: 268 NHIAEYGGDPDRIYLMGQSAGAHIAACTIVEQVIKESGEG 307 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,567,654 Number of Sequences: 28952 Number of extensions: 312604 Number of successful extensions: 745 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -