BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30248 (646 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schiz... 28 1.3 SPAC16E8.13 |||ubiquitin-protein ligase E3 |Schizosaccharomyces ... 27 1.8 SPAC25A8.01c ||snf2SR|fun thirty related protein Fft3|Schizosacc... 25 7.1 >SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 27.9 bits (59), Expect = 1.3 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = +2 Query: 419 SILQKKTGAGRNI--YSQRQGSGHSCHVNVHQ-GVIRAIGWRLGLQAVTGVVFVTFILGT 589 S L K+ GA R + + G+ C V G + A+ W LG+ + V + L T Sbjct: 117 SYLYKRFGAARILPFFMLSFGAMSLCQAAVKNFGGMMAVRWFLGMAESAVLPGVVYYLTT 176 Query: 590 FYRSASL 610 FYR L Sbjct: 177 FYRRTEL 183 >SPAC16E8.13 |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 547 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 197 VLCQRGWHWPCLQ*QWPSASKVYTRY 274 ++CQ +H PCLQ +W ++S RY Sbjct: 225 IVCQHTFHCPCLQ-KWGNSSCPVCRY 249 >SPAC25A8.01c ||snf2SR|fun thirty related protein Fft3|Schizosaccharomyces pombe|chr 1|||Manual Length = 922 Score = 25.4 bits (53), Expect = 7.1 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +1 Query: 520 SDRVATWLAGSHRSSIRYLYSGNILPFGFSVSSPATSNFTFE 645 S +V HR ++R Y+ N L G + P +S T+E Sbjct: 165 SSQVTNQKPAPHRLTMRERYAANNLTNGLQFTLPLSSRKTYE 206 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,482,083 Number of Sequences: 5004 Number of extensions: 47349 Number of successful extensions: 132 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -