BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30245 (501 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82076-1|CAB04934.1| 363|Caenorhabditis elegans Hypothetical pr... 28 4.4 Z66523-9|CAE17856.1| 271|Caenorhabditis elegans Hypothetical pr... 28 4.4 >Z82076-1|CAB04934.1| 363|Caenorhabditis elegans Hypothetical protein W07G1.2 protein. Length = 363 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 183 IYLYISXAFXYISMH*LLLCIYTCCLVRV-XWSL 281 IYL + F + M+ +L C Y C +RV W+L Sbjct: 32 IYLIVYGIFHLLIMYFVLKCAYICLKIRVFHWNL 65 >Z66523-9|CAE17856.1| 271|Caenorhabditis elegans Hypothetical protein M05D6.9 protein. Length = 271 Score = 27.9 bits (59), Expect = 4.4 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = -1 Query: 372 ANVPRLRYRER*KT-----RAMDTVXSNLQT*ERXSNSXKLALSNKYRCTKVINACLCXQ 208 + +PR RYR+R T R + + + S S K ++ R +V+N C Q Sbjct: 20 SRIPRARYRKRGPTGFSLARIQKEYDEDYDSTDDSSTSRKSSVDGSRRRDEVVNDAKCLQ 79 Query: 207 MXSRYINI 184 + +NI Sbjct: 80 KCNNQLNI 87 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,945,203 Number of Sequences: 27780 Number of extensions: 139845 Number of successful extensions: 171 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 956602620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -