BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30243 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 27 0.57 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 9.4 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 9.4 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 23 9.4 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 27.1 bits (57), Expect = 0.57 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = -3 Query: 238 PSPRTSIGASSSSPNLFD-----SKSVSTAGYPMGLRPA*NGLWAFTNAPR 101 PSP +S+G + PNL +S ST+G P G+ N AF P+ Sbjct: 359 PSPPSSLGMPGNIPNLSQLDATGGQSASTSGLPRGIYTYHNAS-AFQQMPK 408 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 9.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 500 RMRSSLPFRKKIIEIRTSSTVEEFVA 423 R+R S R K+I I ++T E+F+A Sbjct: 2044 RLRYSYDNRGKLIGISNAATDEKFIA 2069 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 9.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 500 RMRSSLPFRKKIIEIRTSSTVEEFVA 423 R+R S R K+I I ++T E+F+A Sbjct: 2045 RLRYSYDNRGKLIGISNAATDEKFIA 2070 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 290 YLNWKAYEALRKRP 331 YLNW E LRK P Sbjct: 363 YLNWVVDETLRKYP 376 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 682,422 Number of Sequences: 2352 Number of extensions: 12460 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -