BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30242 (526 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U81524-1|AAB82735.1| 79|Homo sapiens cytochrome c oxidase subu... 32 1.4 M83186-1|AAA52166.1| 79|Homo sapiens cytochrome c oxidase subu... 32 1.4 CR542120-1|CAG46917.1| 79|Homo sapiens COX7A1 protein. 32 1.4 BT006924-1|AAP35570.1| 79|Homo sapiens cytochrome c oxidase su... 32 1.4 BC002757-1|AAH02757.1| 79|Homo sapiens cytochrome c oxidase su... 32 1.4 AF127789-1|AAF72747.1| 79|Homo sapiens cytochrome c oxidase po... 32 1.4 AF037372-1|AAB92616.1| 79|Homo sapiens cytochrome oxidase subu... 32 1.4 AC002984-2|AAB81547.1| 79|Homo sapiens COXK_HUMAN protein. 32 1.4 M55702-1|AAA61219.1| 260|Homo sapiens thyroperoxidase protein. 30 5.7 X15822-1|CAA33820.1| 83|Homo sapiens protein ( Human COX VIIa-... 29 7.6 CR542125-1|CAG46922.1| 83|Homo sapiens COX7A2 protein. 29 7.6 CR407646-1|CAG28574.1| 83|Homo sapiens COX7A2 protein. 29 7.6 BC133654-1|AAI33655.1| 83|Homo sapiens COX7A2 protein protein. 29 7.6 BC101828-1|AAI01829.1| 83|Homo sapiens cytochrome c oxidase su... 29 7.6 BC101826-1|AAI01827.1| 83|Homo sapiens cytochrome c oxidase su... 29 7.6 BC100854-1|AAI00855.1| 83|Homo sapiens cytochrome c oxidase su... 29 7.6 BC100853-1|AAI00854.1| 83|Homo sapiens cytochrome c oxidase su... 29 7.6 BC100852-1|AAI00853.1| 83|Homo sapiens cytochrome c oxidase su... 29 7.6 AL080250-3|CAI19899.1| 115|Homo sapiens cytochrome c oxidase su... 29 7.6 AF134406-1|AAF61396.1| 83|Homo sapiens cytochrome-c oxidase su... 29 7.6 AC004544-1|AAC12952.1| 106|Homo sapiens WUGSC:H_RG162B04.1 prot... 29 10.0 >U81524-1|AAB82735.1| 79|Homo sapiens cytochrome c oxidase subunit VIIa-M protein. Length = 79 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 286 IRRXQELFQRDNXLXVFLKGGPADVI 363 +R Q+LFQ DN + ++LKGG D I Sbjct: 26 VREKQKLFQEDNDIPLYLKGGIVDNI 51 >M83186-1|AAA52166.1| 79|Homo sapiens cytochrome c oxidase subunit VIIa protein. Length = 79 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 286 IRRXQELFQRDNXLXVFLKGGPADVI 363 +R Q+LFQ DN + ++LKGG D I Sbjct: 26 VREKQKLFQEDNDIPLYLKGGIVDNI 51 >CR542120-1|CAG46917.1| 79|Homo sapiens COX7A1 protein. Length = 79 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 286 IRRXQELFQRDNXLXVFLKGGPADVI 363 +R Q+LFQ DN + ++LKGG D I Sbjct: 26 VREKQKLFQEDNDIPLYLKGGIVDNI 51 >BT006924-1|AAP35570.1| 79|Homo sapiens cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) protein. Length = 79 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 286 IRRXQELFQRDNXLXVFLKGGPADVI 363 +R Q+LFQ DN + ++LKGG D I Sbjct: 26 VREKQKLFQEDNDIPLYLKGGIVDNI 51 >BC002757-1|AAH02757.1| 79|Homo sapiens cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) protein. Length = 79 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 286 IRRXQELFQRDNXLXVFLKGGPADVI 363 +R Q+LFQ DN + ++LKGG D I Sbjct: 26 VREKQKLFQEDNDIPLYLKGGIVDNI 51 >AF127789-1|AAF72747.1| 79|Homo sapiens cytochrome c oxidase polypeptide VIIa-heart precursor protein. Length = 79 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 286 IRRXQELFQRDNXLXVFLKGGPADVI 363 +R Q+LFQ DN + ++LKGG D I Sbjct: 26 VREKQKLFQEDNDIPLYLKGGIVDNI 51 >AF037372-1|AAB92616.1| 79|Homo sapiens cytochrome oxidase subunit VIIa-H precursor protein. Length = 79 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 286 IRRXQELFQRDNXLXVFLKGGPADVI 363 +R Q+LFQ DN + ++LKGG D I Sbjct: 26 VREKQKLFQEDNDIPLYLKGGIVDNI 51 >AC002984-2|AAB81547.1| 79|Homo sapiens COXK_HUMAN protein. Length = 79 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 286 IRRXQELFQRDNXLXVFLKGGPADVI 363 +R Q+LFQ DN + ++LKGG D I Sbjct: 26 VREKQKLFQEDNDIPLYLKGGIVDNI 51 >M55702-1|AAA61219.1| 260|Homo sapiens thyroperoxidase protein. Length = 260 Score = 29.9 bits (64), Expect = 5.7 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = -2 Query: 270 WIRSVLPGIRFLFPGAAQASSVTVENWLVLYWITGTSTRCRAMGATGNSGACR 112 WI L + L G A +S + W VL W G T CR +G CR Sbjct: 180 WISMSLAAL--LIGGFAGLTSTVICRWRVLGWKAGILTGCREPSEGKVAGHCR 230 >X15822-1|CAA33820.1| 83|Homo sapiens protein ( Human COX VIIa-L mRNA for liver-specific cytochrome c oxidase (EC ). Length = 83 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDEIPLYLKGGVADAL 53 >CR542125-1|CAG46922.1| 83|Homo sapiens COX7A2 protein. Length = 83 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDEIPLYLKGGVADAL 53 >CR407646-1|CAG28574.1| 83|Homo sapiens COX7A2 protein. Length = 83 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDEIPLYLKGGVADAL 53 >BC133654-1|AAI33655.1| 83|Homo sapiens COX7A2 protein protein. Length = 83 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDEIPLYLKGGVADAL 53 >BC101828-1|AAI01829.1| 83|Homo sapiens cytochrome c oxidase subunit VIIa polypeptide 2 (liver) protein. Length = 83 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDEIPLYLKGGVADAL 53 >BC101826-1|AAI01827.1| 83|Homo sapiens cytochrome c oxidase subunit VIIa polypeptide 2 (liver) protein. Length = 83 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDEIPLYLKGGVADAL 53 >BC100854-1|AAI00855.1| 83|Homo sapiens cytochrome c oxidase subunit VIIa polypeptide 2 (liver) protein. Length = 83 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDEIPLYLKGGVADAL 53 >BC100853-1|AAI00854.1| 83|Homo sapiens cytochrome c oxidase subunit VIIa polypeptide 2 (liver) protein. Length = 83 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDEIPLYLKGGVADAL 53 >BC100852-1|AAI00853.1| 83|Homo sapiens cytochrome c oxidase subunit VIIa polypeptide 2 (liver) protein. Length = 83 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDEIPLYLKGGVADAL 53 >AL080250-3|CAI19899.1| 115|Homo sapiens cytochrome c oxidase subunit VIIa polypeptide 2 (liver) protein. Length = 115 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 64 QKLFQEDDEIPLYLKGGVADAL 85 >AF134406-1|AAF61396.1| 83|Homo sapiens cytochrome-c oxidase subunit VIIaL precursor protein. Length = 83 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDEIPLYLKGGVADAL 53 >AC004544-1|AAC12952.1| 106|Homo sapiens WUGSC:H_RG162B04.1 protein. Length = 106 Score = 29.1 bits (62), Expect = 10.0 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 298 QELFQRDNXLXVFLKGGPADVI 363 Q+LFQ D+ + ++LKGG AD + Sbjct: 32 QKLFQEDDGIPLYLKGGIADAL 53 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,208,033 Number of Sequences: 237096 Number of extensions: 1579660 Number of successful extensions: 3246 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 3132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3246 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5046825278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -