BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30240 (619 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 pr... 24 3.4 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 23 7.9 >AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 protein. Length = 106 Score = 24.2 bits (50), Expect = 3.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -2 Query: 489 GNFIRINIQVVKNDTKIHRNATEIRRIRF 403 G + +NI V++ND + + +A + R RF Sbjct: 35 GTEVMLNIYVMQNDPQYYPDADQFRPERF 63 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.0 bits (47), Expect = 7.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 115 IFMFGISKTVNGIANSPSISLLLVQILTCYFXK 17 I + I + NG+A + S S L I YF K Sbjct: 242 IARYNIERFANGLARTLSFSQLRESIPEAYFPK 274 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,419 Number of Sequences: 2352 Number of extensions: 14093 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -