BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30240 (619 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 1.8 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 1.8 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 7.3 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 7.3 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 9.6 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +1 Query: 358 LHNTRPHTQPDHTKTESNSPYLCGVPMYFS 447 LH+ P DH++ + + YL P +S Sbjct: 120 LHDNSPSFLSDHSRDQEQNLYLTPSPQMYS 149 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.4 bits (48), Expect = 1.8 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 383 NPTTPKLNRILLISVAFLCILVSFFTTWIFMRMK 484 NP+ L +L I FL +L + WIF K Sbjct: 44 NPSLHYLLALLYILFTFLALLGNGLVIWIFCAAK 77 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.0 bits (47), Expect = 2.4 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +3 Query: 87 TVLEIPNIKIKKPTWLQAPSAMTTFSLVLLSYFLVT-GGIIYDVIVEPPSVG 239 T+L K+ +Q P + + +SY T G+IY ++ PS G Sbjct: 805 TILSPVREKLSSSQPMQPPQ-QNPYMFLPVSYMSTTMAGVIYPPVIGTPSTG 855 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 4.2 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +3 Query: 261 TADL*PSCRIVLMVS-TSWKVLRRASSSHSEGLAS*Y*TAHTTRPHQN*IEFSLS 422 T + PS ++ + S TS +L S H+ G + T H H N E LS Sbjct: 1400 TVQVPPSAPVLYVTSSTSSSILLHWKSGHNGGASLTGYTLHYRTAHGNLDELQLS 1454 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 4.2 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +3 Query: 261 TADL*PSCRIVLMVS-TSWKVLRRASSSHSEGLAS*Y*TAHTTRPHQN*IEFSLS 422 T + PS ++ + S TS +L S H+ G + T H H N E LS Sbjct: 1396 TVQVPPSAPVLYVTSSTSSSILLHWKSGHNGGASLTGYTLHYRTAHGNLDELQLS 1450 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 7.3 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 152 DNLFTGVTLLLFGYWRYYLRC--DSRATERGFNDR 250 D F G T + WR+ L+C D + R N R Sbjct: 56 DPWFAGSTNIGINKWRFLLQCLEDLDCSLRKLNSR 90 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 75 AIPFTVLEIPNIKIKKPTWL 134 A PF +E P+I + TWL Sbjct: 328 ATPFVPVEPPDILMPALTWL 347 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 340 EEEARRKTFHDVLTINTIRHEGYRS 266 E++ R+K+ DV + R + Y+S Sbjct: 122 EQKRRKKSLDDVKILRNDRIDSYKS 146 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,125 Number of Sequences: 438 Number of extensions: 3817 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -