BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30236 (420 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49686| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) 27 4.8 SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) 27 6.3 SB_36832| Best HMM Match : DTHCT (HMM E-Value=9.3) 27 8.3 SB_35047| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_49686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 27.9 bits (59), Expect = 3.6 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -2 Query: 302 LASPHGVGATMAAAVNVTQCCRPLNFRSMLVQQRLCFLPLF 180 LASPHG A +A A VT + + L Q R C +F Sbjct: 534 LASPHGGEAPLAVAEMVTNSHTMTSLANFLAQFRHCEAKIF 574 >SB_42271| Best HMM Match : DUF229 (HMM E-Value=0) Length = 591 Score = 27.5 bits (58), Expect = 4.8 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 416 FFFFFTSHRQIY*KFKC--ILIPNKTEKVRSW 327 FFF+F R+++ KC + I N T+ RSW Sbjct: 141 FFFYFKEARRVFENRKCSVVEIINFTDITRSW 172 >SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) Length = 303 Score = 27.1 bits (57), Expect = 6.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 356 PNKTEKVRSWSDVENG*CLASPHGVGATMAAA 261 P K +K R W D ++G C + +G T+AAA Sbjct: 167 PEKLQKARDWDDWKDGLCGVA---IGYTVAAA 195 >SB_36832| Best HMM Match : DTHCT (HMM E-Value=9.3) Length = 225 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 250 VTLTAAAMVAPTP*GDAKHHPFSTSLQDRTFSVLFGIKMHL 372 +TLT + V GD H P ++ + R + +F ++ HL Sbjct: 102 ITLTLISRVGDIRMGDWNHGPLGSAERHREYQPVFLVRAHL 142 >SB_35047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 998 Score = 26.6 bits (56), Expect = 8.3 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 324 RCRERVMFSITSWRGGYHGSSSQRD 250 +CR V+F++ + +G HG+SS D Sbjct: 952 QCRAEVIFTMPNLKGQCHGTSSNDD 976 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,826,012 Number of Sequences: 59808 Number of extensions: 207137 Number of successful extensions: 404 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -