BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30234 (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42045| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_32701| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 41 8e-04 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_46022| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 40 0.001 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 40 0.001 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 40 0.002 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 39 0.003 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 39 0.003 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 39 0.004 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 39 0.004 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 39 0.004 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 38 0.006 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 38 0.006 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 38 0.006 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 38 0.008 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 38 0.010 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 38 0.010 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 38 0.010 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_13275| Best HMM Match : Phycoerythr_ab (HMM E-Value=0.23) 38 0.010 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 38 0.010 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 37 0.014 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 37 0.014 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 37 0.014 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 37 0.014 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 37 0.014 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 37 0.014 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.014 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.014 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 37 0.014 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 37 0.014 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.014 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 37 0.014 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_19232| Best HMM Match : UCR_TM (HMM E-Value=5.1) 37 0.014 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 37 0.014 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 37 0.014 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 37 0.018 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 37 0.018 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 37 0.018 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 37 0.018 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 37 0.018 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 37 0.018 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 37 0.018 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 37 0.018 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 37 0.018 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 37 0.018 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 36 0.024 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 36 0.024 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.024 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 36 0.024 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 36 0.024 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 36 0.024 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 36 0.024 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 36 0.024 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 36 0.024 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.024 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.024 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 36 0.024 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 36 0.024 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 36 0.024 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.024 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 36 0.024 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.024 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 36 0.024 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 36 0.024 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 36 0.024 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 36 0.024 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 36 0.024 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 36 0.024 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 36 0.024 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 36 0.024 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 36 0.024 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 36 0.024 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.024 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 36 0.024 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 36 0.024 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.024 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 >SB_42045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 44.4 bits (100), Expect = 9e-05 Identities = 30/86 (34%), Positives = 37/86 (43%) Frame = +3 Query: 144 YLGKLRGLLGDGNNEPYDDFRLPNGKICTSESEFGNATVWPAAVHRCKRPNTPITSCTMH 323 Y G GL G+ N P DDF + NG+ S+ EFG + W HR +RP C Sbjct: 176 YRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKS--WSLGGHR-RRP------CLQR 226 Query: 324 PSPPPANRSSGEYRRSGPCHCSWTCR 401 PP + RRS H W R Sbjct: 227 APSPPIAEPISKCRRSALHH--WRAR 250 >SB_32701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +3 Query: 90 MVFCTSKLEVCYIEANGFYLGKLRGLLGDGNNEPYDDFRLPNGKICTSESEFGNA 254 +V+ +++++V AN F +LRGL GD N E YD+F+ P G+ + +F A Sbjct: 6 VVYMSNRIQV---HANPFLQNRLRGLCGDMNGEQYDEFQSPTGEFLNNADQFQKA 57 >SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +3 Query: 126 IEANGFYLGKLRGLLGDGNNEPYDDFRLPNGKICTSESEFGNA 254 + AN F +LRGL GD N E YD+F+ P G+ + +F A Sbjct: 1425 VHANPFLQNRLRGLCGDMNGEQYDEFQSPTGEFLNNADQFQKA 1467 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 41.5 bits (93), Expect = 6e-04 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = +3 Query: 24 AALELVDPPGCRNSAPGSLYGLMVFCTS 107 AALELVDPPGCRNS + ++++CTS Sbjct: 66 AALELVDPPGCRNSMKVCVKDILIWCTS 93 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++SL+ NSCSPGDPLVLERP R Sbjct: 30 SISLISNSCSPGDPLVLERPPPR 52 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 87 DRTMSLVPNSCSPGDPLVLERPXHR 13 +R+ S V NSCSPGDPLVLERP R Sbjct: 9 ERSASQVSNSCSPGDPLVLERPPPR 33 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++SL+ NSCSPGDPLVLERP R Sbjct: 30 SISLISNSCSPGDPLVLERPPPR 52 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++SL+ NSCSPGDPLVLERP R Sbjct: 30 SISLISNSCSPGDPLVLERPPPR 52 >SB_46022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -1 Query: 76 EPGAEFLQPGGSTSSRAARPPRWXS 2 E G EFLQPGGSTSSRAA PRW S Sbjct: 12 EKGIEFLQPGGSTSSRAA-TPRWSS 35 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++SL+ NSCSPGDPLVLERP R Sbjct: 30 SISLISNSCSPGDPLVLERPPPR 52 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++SL+ NSCSPGDPLVLERP R Sbjct: 30 SISLISNSCSPGDPLVLERPPPR 52 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++SL+ NSCSPGDPLVLERP R Sbjct: 30 SISLISNSCSPGDPLVLERPPPR 52 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++SL+ NSCSPGDPLVLERP R Sbjct: 31 SISLISNSCSPGDPLVLERPPPR 53 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++SL+ NSCSPGDPLVLERP R Sbjct: 30 SISLISNSCSPGDPLVLERPPPR 52 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++SL+ NSCSPGDPLVLERP R Sbjct: 28 SISLISNSCSPGDPLVLERPPPR 50 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 +SL+ NSCSPGDPLVLERP R Sbjct: 31 VSLISNSCSPGDPLVLERPPPR 52 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 RT L+ NSCSPGDPLVLERP R Sbjct: 2 RTAILLSNSCSPGDPLVLERPPPR 25 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 RT+ V NSCSPGDPLVLERP R Sbjct: 54 RTIPPVSNSCSPGDPLVLERPPPR 77 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = -2 Query: 105 MCRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 M R D +S NSCSPGDPLVLERP R Sbjct: 1 MTTRNIDTNVSYTSNSCSPGDPLVLERPPPR 31 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 1/24 (4%) Frame = -2 Query: 81 TMSLVP-NSCSPGDPLVLERPXHR 13 T+ LVP NSCSPGDPLVLERP R Sbjct: 24 TLPLVPSNSCSPGDPLVLERPPPR 47 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 R +S+ NSCSPGDPLVLERP R Sbjct: 15 RKVSITSNSCSPGDPLVLERPPPR 38 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 S+V NSCSPGDPLVLERP R Sbjct: 346 SIVSNSCSPGDPLVLERPPPR 366 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = -2 Query: 102 CRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 C R R + + NSCSPGDPLVLERP R Sbjct: 35 CARKRARAEAALSNSCSPGDPLVLERPPPR 64 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 T +V NSCSPGDPLVLERP R Sbjct: 82 TQRIVSNSCSPGDPLVLERPPPR 104 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M+L NSCSPGDPLVLERP R Sbjct: 1 MTLASNSCSPGDPLVLERPPPR 22 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -2 Query: 87 DRTMSLVPNSCSPGDPLVLERPXHR 13 D+ V NSCSPGDPLVLERP R Sbjct: 11 DKIADFVSNSCSPGDPLVLERPPPR 35 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/31 (58%), Positives = 19/31 (61%) Frame = -2 Query: 105 MCRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 MCR + NSCSPGDPLVLERP R Sbjct: 8 MCRASRKTRKKIPSNSCSPGDPLVLERPPPR 38 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 + L+ NSCSPGDPLVLERP R Sbjct: 35 LDLISNSCSPGDPLVLERPPPR 56 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 T+ ++ NSCSPGDPLVLERP R Sbjct: 2 TIVIISNSCSPGDPLVLERPPPR 24 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 T L NSCSPGDPLVLERP R Sbjct: 8 TQELTSNSCSPGDPLVLERPPPR 30 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = -2 Query: 129 QCSTPQV*MCRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 QC T Q +RP ++ +S NSCSPGDPLVLERP R Sbjct: 19 QCHTSQN---KRPENKALS---NSCSPGDPLVLERPPPR 51 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 LV NSCSPGDPLVLERP R Sbjct: 24 LVSNSCSPGDPLVLERPPPR 43 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 LV NSCSPGDPLVLERP R Sbjct: 3 LVSNSCSPGDPLVLERPPPR 22 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 LV NSCSPGDPLVLERP R Sbjct: 17 LVSNSCSPGDPLVLERPPPR 36 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/30 (60%), Positives = 19/30 (63%) Frame = -2 Query: 102 CRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 C R D + NSCSPGDPLVLERP R Sbjct: 45 CMRSPDAHCRVPSNSCSPGDPLVLERPPPR 74 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 LV NSCSPGDPLVLERP R Sbjct: 9 LVSNSCSPGDPLVLERPPPR 28 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -2 Query: 96 RP*DRTMSLVPNSCSPGDPLVLERPXHR 13 RP M + NSCSPGDPLVLERP R Sbjct: 17 RPCAVIMRITSNSCSPGDPLVLERPPPR 44 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 LV NSCSPGDPLVLERP R Sbjct: 5 LVSNSCSPGDPLVLERPPPR 24 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 LV NSCSPGDPLVLERP R Sbjct: 2 LVSNSCSPGDPLVLERPPPR 21 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 +++V NSCSPGDPLVLERP R Sbjct: 17 LTVVSNSCSPGDPLVLERPPPR 38 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 S V NSCSPGDPLVLERP R Sbjct: 12 SFVSNSCSPGDPLVLERPPPR 32 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 LV NSCSPGDPLVLERP R Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 LV NSCSPGDPLVLERP R Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 SL NSCSPGDPLVLERP R Sbjct: 14 SLTSNSCSPGDPLVLERPPPR 34 >SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 TM + NSCSPGDPLVLERP R Sbjct: 65 TMVIESNSCSPGDPLVLERPPPR 87 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L+ NSCSPGDPLVLERP R Sbjct: 17 LISNSCSPGDPLVLERPPPR 36 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/30 (60%), Positives = 19/30 (63%) Frame = -2 Query: 102 CRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 CR + S NSCSPGDPLVLERP R Sbjct: 8 CRGEQGKYKSSTSNSCSPGDPLVLERPPPR 37 >SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 85 PYNEPGAEFLQPGGSTSSRAA 23 P N P EFLQPGGSTSSRAA Sbjct: 36 PQNRPDIEFLQPGGSTSSRAA 56 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 TM NSCSPGDPLVLERP R Sbjct: 6 TMPRASNSCSPGDPLVLERPPPR 28 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 ++V NSCSPGDPLVLERP R Sbjct: 76 TIVSNSCSPGDPLVLERPPPR 96 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L+ NSCSPGDPLVLERP R Sbjct: 8 LISNSCSPGDPLVLERPPPR 27 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -2 Query: 87 DRTMSLVPNSCSPGDPLVLERPXHR 13 D + + NSCSPGDPLVLERP R Sbjct: 72 DHELRFLSNSCSPGDPLVLERPPPR 96 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 +++ V NSCSPGDPLVLERP R Sbjct: 15 SIAFVSNSCSPGDPLVLERPPPR 37 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 38.7 bits (86), Expect = 0.004 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -2 Query: 180 YRLREDREVYPSRSR*LQCSTPQV*MCRRP*DRTMSLVP-NSCSPGDPLVLERPXHR 13 + + +D E+ P S C+ P + C P L P NSCSPGDPLVLERP R Sbjct: 25 FTMAQDGELIPHLS---PCTPPLLSPCTPP-----HLSPSNSCSPGDPLVLERPPPR 73 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L+ NSCSPGDPLVLERP R Sbjct: 24 LISNSCSPGDPLVLERPPPR 43 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 T+ ++ NSCSPGDPLVLERP R Sbjct: 62 TVFMLSNSCSPGDPLVLERPPPR 84 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -2 Query: 87 DRTMSLVPNSCSPGDPLVLERPXHR 13 DR + NSCSPGDPLVLERP R Sbjct: 7 DRESYALSNSCSPGDPLVLERPPPR 31 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L+ NSCSPGDPLVLERP R Sbjct: 40 LISNSCSPGDPLVLERPPPR 59 >SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M + NSCSPGDPLVLERP R Sbjct: 1 MKITSNSCSPGDPLVLERPPPR 22 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = -2 Query: 132 LQCSTPQV*MCRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 L+ P + P +R NSCSPGDPLVLERP R Sbjct: 3 LKSGIPAAVLTPAPVERQHVAASNSCSPGDPLVLERPPPR 42 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 +SL NSCSPGDPLVLERP R Sbjct: 4 VSLSSNSCSPGDPLVLERPPPR 25 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L+ NSCSPGDPLVLERP R Sbjct: 70 LISNSCSPGDPLVLERPPPR 89 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 +S V NSCSPGDPLVLERP R Sbjct: 14 VSKVSNSCSPGDPLVLERPPPR 35 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 ++V NSCSPGDPLVLERP R Sbjct: 12 NIVSNSCSPGDPLVLERPPPR 32 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L+ NSCSPGDPLVLERP R Sbjct: 21 LISNSCSPGDPLVLERPPPR 40 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L+ NSCSPGDPLVLERP R Sbjct: 16 LISNSCSPGDPLVLERPPPR 35 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++ L NSCSPGDPLVLERP R Sbjct: 658 SLQLASNSCSPGDPLVLERPPPR 680 >SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M + NSCSPGDPLVLERP R Sbjct: 1 MGITSNSCSPGDPLVLERPPPR 22 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -1 Query: 112 SLDVQKTMRPYNEPGAEFLQPGGSTSSRAA 23 S DV+ T +E EFLQPGGSTSSRAA Sbjct: 36 SKDVKLTQHTVSEKEIEFLQPGGSTSSRAA 65 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = -2 Query: 102 CRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 C + T + NSCSPGDPLVLERP R Sbjct: 51 CHHMDEPTAKKLSNSCSPGDPLVLERPPPR 80 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +L+ NSCSPGDPLVLERP R Sbjct: 61 TLLSNSCSPGDPLVLERPPPR 81 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 102 CRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 CR S NSCSPGDPLVLERP R Sbjct: 3 CRGEITEINSTASNSCSPGDPLVLERPPPR 32 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -2 Query: 105 MCRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 +C++ D +S NSCSPGDPLVLERP R Sbjct: 24 LCKKSQD--ISKTSNSCSPGDPLVLERPPPR 52 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 SL NSCSPGDPLVLERP R Sbjct: 3 SLSSNSCSPGDPLVLERPPPR 23 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 R S NSCSPGDPLVLERP R Sbjct: 61 RKSSTTSNSCSPGDPLVLERPPPR 84 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 102 CRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 CR+ R ++ NSCSPGDPLVLERP R Sbjct: 70 CRKQRSREVA-TSNSCSPGDPLVLERPPPR 98 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M L NSCSPGDPLVLERP R Sbjct: 1 MRLSSNSCSPGDPLVLERPPPR 22 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/23 (82%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 78 MSL-VPNSCSPGDPLVLERPXHR 13 MSL V NSCSPGDPLVLERP R Sbjct: 1 MSLHVSNSCSPGDPLVLERPPPR 23 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M V NSCSPGDPLVLERP R Sbjct: 1 MEHVSNSCSPGDPLVLERPPPR 22 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +++ NSCSPGDPLVLERP R Sbjct: 12 NIISNSCSPGDPLVLERPPPR 32 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M V NSCSPGDPLVLERP R Sbjct: 1 MLYVSNSCSPGDPLVLERPPPR 22 >SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/31 (58%), Positives = 19/31 (61%) Frame = -2 Query: 105 MCRRP*DRTMSLVPNSCSPGDPLVLERPXHR 13 + R P M NSCSPGDPLVLERP R Sbjct: 5 LSRNPTTYRMFFQSNSCSPGDPLVLERPPPR 35 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +L+ NSCSPGDPLVLERP R Sbjct: 1 TLLSNSCSPGDPLVLERPPPR 21 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 +V NSCSPGDPLVLERP R Sbjct: 11 MVSNSCSPGDPLVLERPPPR 30 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 +V NSCSPGDPLVLERP R Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M V NSCSPGDPLVLERP R Sbjct: 1 MRRVSNSCSPGDPLVLERPPPR 22 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -2 Query: 87 DRTMSLVPNSCSPGDPLVLERPXHR 13 D T NSCSPGDPLVLERP R Sbjct: 13 DHTERRASNSCSPGDPLVLERPPPR 37 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +++ NSCSPGDPLVLERP R Sbjct: 3 TIISNSCSPGDPLVLERPPPR 23 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 +V NSCSPGDPLVLERP R Sbjct: 6 IVSNSCSPGDPLVLERPPPR 25 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 + ++ V NSCSPGDPLVLERP R Sbjct: 18 KRVNAVSNSCSPGDPLVLERPPPR 41 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 +V NSCSPGDPLVLERP R Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +++ NSCSPGDPLVLERP R Sbjct: 12 NIISNSCSPGDPLVLERPPPR 32 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -2 Query: 87 DRTMSLVPNSCSPGDPLVLERPXHR 13 D +L NSCSPGDPLVLERP R Sbjct: 91 DIKRALASNSCSPGDPLVLERPPPR 115 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M + NSCSPGDPLVLERP R Sbjct: 31 MEYLSNSCSPGDPLVLERPPPR 52 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 3/24 (12%) Frame = -2 Query: 75 SLVP---NSCSPGDPLVLERPXHR 13 SLVP NSCSPGDPLVLERP R Sbjct: 21 SLVPRPSNSCSPGDPLVLERPPPR 44 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 17 IISNSCSPGDPLVLERPPPR 36 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 R ++ NSCSPGDPLVLERP R Sbjct: 8 RITKVLSNSCSPGDPLVLERPPPR 31 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +L NSCSPGDPLVLERP R Sbjct: 14 ALTSNSCSPGDPLVLERPPPR 34 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 119 IISNSCSPGDPLVLERPPPR 138 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 S + NSCSPGDPLVLERP R Sbjct: 57 SSISNSCSPGDPLVLERPPPR 77 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M + NSCSPGDPLVLERP R Sbjct: 1 MVITSNSCSPGDPLVLERPPPR 22 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 +V NSCSPGDPLVLERP R Sbjct: 3474 VVSNSCSPGDPLVLERPPPR 3493 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 S + NSCSPGDPLVLERP R Sbjct: 2 SQISNSCSPGDPLVLERPPPR 22 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 14 IISNSCSPGDPLVLERPPPR 33 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +L NSCSPGDPLVLERP R Sbjct: 5 TLASNSCSPGDPLVLERPPPR 25 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 +V NSCSPGDPLVLERP R Sbjct: 7 VVSNSCSPGDPLVLERPPPR 26 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L+ NSCSPGDPLVLERP R Sbjct: 54 LLSNSCSPGDPLVLERPPPR 73 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M V NSCSPGDPLVLERP R Sbjct: 1 MEGVSNSCSPGDPLVLERPPPR 22 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 85 PYNEPGAEFLQPGGSTSSRAA 23 PY P EFLQPGGSTSSRAA Sbjct: 20 PYYTPPIEFLQPGGSTSSRAA 40 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +++ NSCSPGDPLVLERP R Sbjct: 4 NVISNSCSPGDPLVLERPPPR 24 >SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -1 Query: 79 NEPGAEFLQPGGSTSSRAA 23 NE G EFLQPGGSTSSRAA Sbjct: 12 NESGIEFLQPGGSTSSRAA 30 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 ++ V NSCSPGDPLVLERP R Sbjct: 7 ITAVSNSCSPGDPLVLERPPPR 28 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 1 MISNSCSPGDPLVLERPPPR 20 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 S+ NSCSPGDPLVLERP R Sbjct: 6 SVTSNSCSPGDPLVLERPPPR 26 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 ++ + NSCSPGDPLVLERP R Sbjct: 49 IAFISNSCSPGDPLVLERPPPR 70 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L+ NSCSPGDPLVLERP R Sbjct: 1 LLSNSCSPGDPLVLERPPPR 20 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L+ NSCSPGDPLVLERP R Sbjct: 7 LLSNSCSPGDPLVLERPPPR 26 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 +V NSCSPGDPLVLERP R Sbjct: 27 VVSNSCSPGDPLVLERPPPR 46 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 S + NSCSPGDPLVLERP R Sbjct: 4 SKISNSCSPGDPLVLERPPPR 24 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M V NSCSPGDPLVLERP R Sbjct: 6 MLRVSNSCSPGDPLVLERPPPR 27 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 26 IISNSCSPGDPLVLERPPPR 45 >SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 R+ + NSCSPGDPLVLERP R Sbjct: 2 RSRLITSNSCSPGDPLVLERPPPR 25 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/23 (73%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 78 MSLVP-NSCSPGDPLVLERPXHR 13 + L+P NSCSPGDPLVLERP R Sbjct: 22 LQLLPSNSCSPGDPLVLERPPPR 44 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 S NSCSPGDPLVLERP R Sbjct: 12 SFTSNSCSPGDPLVLERPPPR 32 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +++ NSCSPGDPLVLERP R Sbjct: 12 NILSNSCSPGDPLVLERPPPR 32 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 2 VSNSCSPGDPLVLERPPPR 20 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 40 VSNSCSPGDPLVLERPPPR 58 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 117 VSNSCSPGDPLVLERPPPR 135 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -2 Query: 87 DRTMSLVPNSCSPGDPLVLERPXHR 13 D+ NSCSPGDPLVLERP R Sbjct: 235 DKLKKKTSNSCSPGDPLVLERPPPR 259 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 184 VSNSCSPGDPLVLERPPPR 202 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 1066 VSNSCSPGDPLVLERPPPR 1084 >SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 M + NSCSPGDPLVLERP R Sbjct: 1 MKIGSNSCSPGDPLVLERPPPR 22 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 14 VISNSCSPGDPLVLERPPPR 33 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 ++S NSCSPGDPLVLERP R Sbjct: 7 SLSYQSNSCSPGDPLVLERPPPR 29 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 78 LTSNSCSPGDPLVLERPPPR 97 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 214 VSNSCSPGDPLVLERPPPR 232 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 + L NSCSPGDPLVLERP R Sbjct: 32 LKLSSNSCSPGDPLVLERPPPR 53 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 5 LASNSCSPGDPLVLERPPPR 24 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 64 VSNSCSPGDPLVLERPPPR 82 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 ++ S NSCSPGDPLVLERP R Sbjct: 47 KSSSRASNSCSPGDPLVLERPPPR 70 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 11 VSNSCSPGDPLVLERPPPR 29 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 25 VSNSCSPGDPLVLERPPPR 43 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 17 LASNSCSPGDPLVLERPPPR 36 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 R + NSCSPGDPLVLERP R Sbjct: 969 RRKGWISNSCSPGDPLVLERPPPR 992 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 +++ NSCSPGDPLVLERP R Sbjct: 2 VTIASNSCSPGDPLVLERPPPR 23 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 +T NSCSPGDPLVLERP R Sbjct: 47 KTEDTTSNSCSPGDPLVLERPPPR 70 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 31 VSNSCSPGDPLVLERPPPR 49 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 41 VSNSCSPGDPLVLERPPPR 59 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/24 (70%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -2 Query: 81 TMSLVP-NSCSPGDPLVLERPXHR 13 ++ VP NSCSPGDPLVLERP R Sbjct: 8 SLGFVPSNSCSPGDPLVLERPPPR 31 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 R + NSCSPGDPLVLERP R Sbjct: 21 RHLQAASNSCSPGDPLVLERPPPR 44 >SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/23 (73%), Positives = 21/23 (91%) Frame = -1 Query: 91 MRPYNEPGAEFLQPGGSTSSRAA 23 M+P+++P EFLQPGGSTSSRAA Sbjct: 1 MKPFSKP-IEFLQPGGSTSSRAA 22 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 R + NSCSPGDPLVLERP R Sbjct: 8 RQLKKASNSCSPGDPLVLERPPPR 31 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 6 VSNSCSPGDPLVLERPPPR 24 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 37 LTSNSCSPGDPLVLERPPPR 56 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 20 LASNSCSPGDPLVLERPPPR 39 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +2 Query: 11 PRWXGRSRTSGSPGLQEFGTRLI 79 PR GRSRTSGSPG QEF +LI Sbjct: 6 PRGGGRSRTSGSPGQQEFDIKLI 28 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 88 LTSNSCSPGDPLVLERPPPR 107 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 17 VISNSCSPGDPLVLERPPPR 36 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 8 VSNSCSPGDPLVLERPPPR 26 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_13275| Best HMM Match : Phycoerythr_ab (HMM E-Value=0.23) Length = 250 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLIVRSHGLL 100 R GRSRTSGSPGLQEF + S G++ Sbjct: 7 RGGGRSRTSGSPGLQEFDVNNSIGSEGMI 35 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 27 VSNSCSPGDPLVLERPPPR 45 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 7 LASNSCSPGDPLVLERPPPR 26 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 193 VSNSCSPGDPLVLERPPPR 211 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 R + + NSCSPGDPLVLERP R Sbjct: 46 RRVYVTSNSCSPGDPLVLERPPPR 69 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 25 VISNSCSPGDPLVLERPPPR 44 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 11 LTSNSCSPGDPLVLERPPPR 30 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 L NSCSPGDPLVLERP R Sbjct: 4 LASNSCSPGDPLVLERPPPR 23 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 V NSCSPGDPLVLERP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLI 79 R GRSRTSGSPGLQEF +LI Sbjct: 7 RGGGRSRTSGSPGLQEFDIKLI 28 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 12 NIASNSCSPGDPLVLERPPPR 32 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 101 ISNSCSPGDPLVLERPPPR 119 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 ++ + NSCSPGDPLVLERP R Sbjct: 512 VTFLSNSCSPGDPLVLERPPPR 533 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 +S NSCSPGDPLVLERP R Sbjct: 3 LSTQSNSCSPGDPLVLERPPPR 24 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 261 ISNSCSPGDPLVLERPPPR 279 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLI 79 R GRSRTSGSPGLQEF +LI Sbjct: 7 RGGGRSRTSGSPGLQEFDIKLI 28 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 S+ NSCSPGDPLVLERP R Sbjct: 110 SVESNSCSPGDPLVLERPPPR 130 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 36 NIASNSCSPGDPLVLERPPPR 56 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLI 79 R GRSRTSGSPGLQEF +LI Sbjct: 7 RGGGRSRTSGSPGLQEFDIKLI 28 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +L NSCSPGDPLVLERP R Sbjct: 22 ALSSNSCSPGDPLVLERPPPR 42 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 + + NSCSPGDPLVLERP R Sbjct: 78 KRQQMASNSCSPGDPLVLERPPPR 101 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 ++ + NSCSPGDPLVLERP R Sbjct: 13 KSFRVTSNSCSPGDPLVLERPPPR 36 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 9 ISNSCSPGDPLVLERPPPR 27 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 3 ISNSCSPGDPLVLERPPPR 21 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 72 LVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 55 ILSNSCSPGDPLVLERPPPR 74 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 13 ISNSCSPGDPLVLERPPPR 31 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLI 79 R GRSRTSGSPGLQEF +LI Sbjct: 7 RGGGRSRTSGSPGLQEFDIKLI 28 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 52 ISNSCSPGDPLVLERPPPR 70 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 51 ISNSCSPGDPLVLERPPPR 69 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 +S + NSCSPGDPLVLERP R Sbjct: 8 ISELSNSCSPGDPLVLERPPPR 29 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 + + NSCSPGDPLVLERP R Sbjct: 16 IKITSNSCSPGDPLVLERPPPR 37 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -2 Query: 78 MSLVPNSCSPGDPLVLERPXHR 13 + ++ NSCSPGDPLVLERP R Sbjct: 31 IGVLSNSCSPGDPLVLERPPPR 52 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLI 79 R GRSRTSGSPGLQEF +LI Sbjct: 7 RGGGRSRTSGSPGLQEFDIKLI 28 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 152 ISNSCSPGDPLVLERPPPR 170 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -2 Query: 96 RP*DRTMSLVPNSCSPGDPLVLERPXHR 13 RP + + NSCSPGDPLVLERP R Sbjct: 178 RPCYTDLVIQSNSCSPGDPLVLERPPPR 205 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 47 ISNSCSPGDPLVLERPPPR 65 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLI 79 R GRSRTSGSPGLQEF +LI Sbjct: 7 RGGGRSRTSGSPGLQEFDIKLI 28 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -2 Query: 87 DRTMSLVPNSCSPGDPLVLERPXHR 13 ++ + NSCSPGDPLVLERP R Sbjct: 22 EKHVKFTSNSCSPGDPLVLERPPPR 46 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 7 ISNSCSPGDPLVLERPPPR 25 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLI 79 R GRSRTSGSPGLQEF +LI Sbjct: 7 RGGGRSRTSGSPGLQEFDIKLI 28 >SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) Length = 119 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLI 79 R GRSRTSGSPGLQEF +LI Sbjct: 7 RGGGRSRTSGSPGLQEFDIKLI 28 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 81 TMSLVPNSCSPGDPLVLERPXHR 13 T L NSCSPGDPLVLERP R Sbjct: 62 TPILPSNSCSPGDPLVLERPPPR 84 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 12 NITSNSCSPGDPLVLERPPPR 32 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 S + NSCSPGDPLVLERP R Sbjct: 5 SQLSNSCSPGDPLVLERPPPR 25 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 84 RTMSLVPNSCSPGDPLVLERPXHR 13 R L NSCSPGDPLVLERP R Sbjct: 62 RFPKLSSNSCSPGDPLVLERPPPR 85 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 18 ISNSCSPGDPLVLERPPPR 36 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 2420 AIASNSCSPGDPLVLERPPPR 2440 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 +++ NSCSPGDPLVLERP R Sbjct: 18 TVLSNSCSPGDPLVLERPPPR 38 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLI 79 R GRSRTSGSPGLQEF +LI Sbjct: 7 RGGGRSRTSGSPGLQEFDIKLI 28 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 6 ISNSCSPGDPLVLERPPPR 24 >SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 S+ NSCSPGDPLVLERP R Sbjct: 3 SIGSNSCSPGDPLVLERPPPR 23 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 1 ISNSCSPGDPLVLERPPPR 19 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 75 SLVPNSCSPGDPLVLERPXHR 13 ++ NSCSPGDPLVLERP R Sbjct: 45 TITSNSCSPGDPLVLERPPPR 65 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +2 Query: 14 RWXGRSRTSGSPGLQEFGTRLI 79 R GRSRTSGSPGLQEF +LI Sbjct: 7 RGGGRSRTSGSPGLQEFDIKLI 28 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 93 P*DRTMSLVPNSCSPGDPLVLERPXHR 13 P + + NSCSPGDPLVLERP R Sbjct: 29 PMQHAIPALSNSCSPGDPLVLERPPPR 55 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 116 ISNSCSPGDPLVLERPPPR 134 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -2 Query: 69 VPNSCSPGDPLVLERPXHR 13 + NSCSPGDPLVLERP R Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,265,545 Number of Sequences: 59808 Number of extensions: 540443 Number of successful extensions: 4269 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4262 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -