BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30233 (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 118 2e-28 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 26 1.0 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.1 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 5.5 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 5.5 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 118 bits (284), Expect = 2e-28 Identities = 56/66 (84%), Positives = 61/66 (92%) Frame = +3 Query: 510 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFXLGGGTFDVSI 689 FNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIF LGGGTFDVSI Sbjct: 10 FNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSI 69 Query: 690 LTIEDG 707 LTI++G Sbjct: 70 LTIDEG 75 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 26.2 bits (55), Expect = 1.0 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -1 Query: 263 IVLWGSSPPGSWRHLR*DARCL*TQHK-TEWSCC 165 IV+WG PPG + R D R ++ K ++ +CC Sbjct: 329 IVVWGKRPPGEAENSR-DQRMAKSKRKFSQQNCC 361 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.1 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 64 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 165 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.5 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 718 TSKIPSSMVRMDTSKVPPPXSKISTFRSPVPFLS-RP*AIAAA 593 T+K+ + M T+ PPP ++ +P P + +P + AAA Sbjct: 572 TTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAA 614 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.5 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -2 Query: 718 TSKIPSSMVRMDTSKVPPPXSKISTFRSPVPFLS-RP*AIAAA 593 T+K+ + M T+ PPP ++ +P P + +P + AAA Sbjct: 571 TTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAA 613 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 822,912 Number of Sequences: 2352 Number of extensions: 18721 Number of successful extensions: 37 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -