BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30228 (518 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC645.14c |sti1||chaperone activator Sti1 |Schizosaccharomyces... 25 6.8 SPAC17H9.20 |psc3|SPAC607.01|mitotic cohesin complex, non-SMC su... 25 6.8 SPAC4G9.09c |arg11||N-acetyl-gamma-glutamyl-phosphate reductase/... 25 9.0 >SPCC645.14c |sti1||chaperone activator Sti1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 591 Score = 25.0 bits (52), Expect = 6.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 217 IPTCTGIIYRGQYVRSNYILYTSLITRLKITYDR 116 I TC I +G+ +R+++ L + RL TY + Sbjct: 318 IKTCEDAIEQGRELRADFKLIAKALGRLGTTYQK 351 >SPAC17H9.20 |psc3|SPAC607.01|mitotic cohesin complex, non-SMC subunit Psc3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 962 Score = 25.0 bits (52), Expect = 6.8 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 61 YTITNKNLHFRNYAQRL 11 Y + +KNL FRN+ +RL Sbjct: 164 YPLNSKNLKFRNFRKRL 180 >SPAC4G9.09c |arg11||N-acetyl-gamma-glutamyl-phosphate reductase/acetylglutamate kinase|Schizosaccharomyces pombe|chr 1|||Manual Length = 885 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +3 Query: 204 VHVGI*NNGYTH*TLIKLICQSCSIYNKKQYKVMLLPSSK 323 V G+ NG H T L+C + S+ K+++ P + Sbjct: 9 VKSGLVRNGAKHCTKRSLLCSNASVIASKRFQGSFAPGQQ 48 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,036,461 Number of Sequences: 5004 Number of extensions: 38495 Number of successful extensions: 70 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 210309424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -