BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30228 (518 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0649 - 18402976-18403220,18403305-18404499 30 0.97 02_01_0087 + 623174-623421,623576-623693,624266-624588,625267-62... 27 6.8 >04_03_0649 - 18402976-18403220,18403305-18404499 Length = 479 Score = 30.3 bits (65), Expect = 0.97 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +2 Query: 200 ASACGNIK*WIYPLNFD*TNMSIMLNLQQETVQSNASTEFQ 322 A+ CG + +++P+N+D N+++ Q Q+ S EF+ Sbjct: 373 AARCGLLGYFLWPVNYDDANLTVSRRASQVWTQTKISPEFK 413 >02_01_0087 + 623174-623421,623576-623693,624266-624588,625267-625551, 625643-625823,625964-626119 Length = 436 Score = 27.5 bits (58), Expect = 6.8 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 7/48 (14%) Frame = -1 Query: 473 MFMSWYHQRGTADV---TSGSTQ----MTLLFIMKSNQSTQYRQCVNY 351 ++MS YHQRGT DV S Q ++LF+M + ST Y ++Y Sbjct: 378 LYMSLYHQRGTEDVMFYLSREAQDGRVKSVLFLMPCH-STPYYSTLHY 424 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,872,347 Number of Sequences: 37544 Number of extensions: 206830 Number of successful extensions: 369 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -