BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30225 (658 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 6.7 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 6.7 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 6.7 Identities = 13/52 (25%), Positives = 21/52 (40%) Frame = -2 Query: 357 CYNTTSYKSRQ*RNEFKMAAANGDHALSL*TITVLVAHGAYCIQKKYQFKYI 202 C NT +YKS + D A L ++ V H +KY +++ Sbjct: 66 CNNTANYKSEAQNQPSSYKQPSSDMADVLLSLKHAVVHPGQSPAEKYDQQHL 117 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 491 TLFLFLHLSIKAACFTSNC 547 T++ HL+I +C ++NC Sbjct: 247 TIYEMYHLAILWSCTSTNC 265 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,213 Number of Sequences: 336 Number of extensions: 2481 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -