BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30225 (658 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1257 - 25646029-25646054,25646139-25646236,25646609-256467... 27 9.9 >08_02_1257 - 25646029-25646054,25646139-25646236,25646609-25646700, 25646786-25646893,25647212-25647346,25647648-25647752, 25647951-25648088,25648865-25648963,25649079-25649195, 25649446-25649610,25649955-25650014,25650395-25650559, 25650636-25650746,25651220-25651333,25651466-25651531, 25651857-25651994,25652303-25652386,25652468-25652510, 25652621-25652676,25652772-25652880,25652944-25653026, 25653127-25653210,25653383-25653454,25653557-25653634, 25653717-25653800,25653892-25653962,25654095-25654164, 25654314-25654403,25654500-25654661,25654702-25654817, 25654946-25654988,25655069-25655185,25655897-25656046 Length = 1082 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/58 (27%), Positives = 24/58 (41%) Frame = -3 Query: 473 CLSWIAARSAHLPMTLIKGNKRQTFIESDSHKQRYVIGFVTIQLLISRANKETNLKWR 300 C SW+A + PM+ K N+ + IE + + F I R KE W+ Sbjct: 630 CKSWLALDGSVQPMSAEKYNECKKSIEDMATSSLRCVAFAYCPCEIERIPKEDIADWK 687 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,025,004 Number of Sequences: 37544 Number of extensions: 211628 Number of successful extensions: 358 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 358 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -