BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30225 (658 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 29 3.3 SB_25345| Best HMM Match : DUF866 (HMM E-Value=2.3) 28 7.7 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 139 RENIARRDSVRDKVRTIDYTLNIFELIFFLYAVRAVC 249 R+N R S+R VR + + +F + L A+R++C Sbjct: 440 RQNSVNRRSIRSSVRVLGAMILLFVFCWVLSAIRSLC 476 >SB_25345| Best HMM Match : DUF866 (HMM E-Value=2.3) Length = 257 Score = 27.9 bits (59), Expect = 7.7 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = -2 Query: 531 HAALIDKCKNKNKVIGYFELPLLDRCSVGSSTNDAYQREQKTNIH*IGQS*TTLCNW 361 HA+L+ N+ +V L D C +GS++ YQ +Q T IH S +C+W Sbjct: 206 HASLMHCASNEARV-------LHDHCPIGSTSWCKYQTKQTTPIH---LSTVLVCHW 252 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,695,416 Number of Sequences: 59808 Number of extensions: 273697 Number of successful extensions: 396 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -