BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30221 (387 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55800.1 68418.m06954 DC1 domain-containing protein contains ... 31 0.36 At4g15840.1 68417.m02409 expressed protein 29 0.82 At2g21300.1 68415.m02535 kinesin motor family protein contains P... 27 3.3 At5g07790.1 68418.m00892 expressed protein 27 4.4 >At5g55800.1 68418.m06954 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 578 Score = 30.7 bits (66), Expect = 0.36 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 7/53 (13%) Frame = +2 Query: 167 CTSILRKFSGRQHCV----TVDCCCHGSPHAMRYAKHH---PFSTSLQDRTFS 304 C SI +KF C+ + C G PH +R ++HH F++SL TFS Sbjct: 203 CASI-KKFDPTYICIQCVFAIHKDCRGFPHVIRISRHHHRISFTSSLLSGTFS 254 >At4g15840.1 68417.m02409 expressed protein Length = 660 Score = 29.5 bits (63), Expect = 0.82 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 104 ISGSRARFQLSGNSGRKHSRCCTSILRKFSG 196 +SGS FQ S NS R CTS++ K G Sbjct: 115 VSGSNLVFQQSSNSQTNFGRPCTSVVDKTEG 145 >At2g21300.1 68415.m02535 kinesin motor family protein contains Pfam profile: kinesin motor domain PF00225 Length = 862 Score = 27.5 bits (58), Expect = 3.3 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 14 KLKEHGASSCISGKRGRRCCNIWHWGSVDSISG 112 K+ EH ASS R N W GSV ISG Sbjct: 425 KMVEHDASSKAGTPHFRNRTNKWEDGSVSEISG 457 >At5g07790.1 68418.m00892 expressed protein Length = 616 Score = 27.1 bits (57), Expect = 4.4 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 35 SSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSI 178 S + KR RR + G+ +S + A +S SGR+ + C TS+ Sbjct: 411 SGRVKRKRSRRISLVAE-GNYQQVSAAEAIVDISRKSGRETAACITSL 457 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,650,609 Number of Sequences: 28952 Number of extensions: 143614 Number of successful extensions: 319 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 319 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 547638520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -