BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= heS30219
(575 letters)
Database: arabidopsis
28,952 sequences; 12,070,560 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
At1g48310.1 68414.m05396 SNF2 domain-containing protein / helica... 28 3.9
>At1g48310.1 68414.m05396 SNF2 domain-containing protein / helicase
domain-containing protein contains similarity to
DNA-dependent ATPase A GI:6651385 from [Bos taurus]};
contains PFam profiles PF00271: Helicase conserved
C-terminal domain, PF00176: SNF2
Length = 673
Score = 28.3 bits (60), Expect = 3.9
Identities = 12/42 (28%), Positives = 28/42 (66%), Gaps = 1/42 (2%)
Frame = +2
Query: 92 HKMMKNIMRKNLMIKIMKKEVIT-MKTRKVMKDFLEISDGSM 214
H + N+M+ +MI+ +KK+V+T + +++ + FL+++ M
Sbjct: 380 HDELHNLMKATVMIRRLKKDVLTELPSKRRQQVFLDLAAKDM 421
Database: arabidopsis
Posted date: Oct 4, 2007 10:56 AM
Number of letters in database: 12,070,560
Number of sequences in database: 28,952
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,536,742
Number of Sequences: 28952
Number of extensions: 134281
Number of successful extensions: 337
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 335
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 337
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1121903184
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -