BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30219 (575 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48310.1 68414.m05396 SNF2 domain-containing protein / helica... 28 3.9 >At1g48310.1 68414.m05396 SNF2 domain-containing protein / helicase domain-containing protein contains similarity to DNA-dependent ATPase A GI:6651385 from [Bos taurus]}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 Length = 673 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/42 (28%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +2 Query: 92 HKMMKNIMRKNLMIKIMKKEVIT-MKTRKVMKDFLEISDGSM 214 H + N+M+ +MI+ +KK+V+T + +++ + FL+++ M Sbjct: 380 HDELHNLMKATVMIRRLKKDVLTELPSKRRQQVFLDLAAKDM 421 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,536,742 Number of Sequences: 28952 Number of extensions: 134281 Number of successful extensions: 337 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1121903184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -