BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30205 (586 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_20318| Best HMM Match : VPS9 (HMM E-Value=7.2) 28 4.9 SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44) 28 4.9 SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) 28 6.4 >SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 103 bits (246), Expect = 1e-22 Identities = 45/82 (54%), Positives = 59/82 (71%) Frame = +1 Query: 10 LREYEVIGRKLPSENEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVXXXX 189 L+E++VIGR +P++ PPLYKMRIF+PD +VA+S+FWYF+ QLK+ KK+ GEIV Sbjct: 207 LKEFQVIGRLMPNKKLTVPPLYKMRIFAPDDVVARSKFWYFISQLKRMKKSQGEIVSCQQ 266 Query: 190 XXXXXXXXXXNFGIWLRYESRS 255 NFGIWLRY+SRS Sbjct: 267 IYEKKPLQIKNFGIWLRYDSRS 288 Score = 98.3 bits (234), Expect = 4e-21 Identities = 44/58 (75%), Positives = 48/58 (82%) Frame = +3 Query: 255 GVHNMYREYRDLSVGGAVTQCYRDMGARHRARAHSIQIIKVEVIKAAACRRPQVKQFH 428 G HNMYREYRDL+V GAVT CYRDM ARHRAR +SIQI+KVEVI A+ RRP VKQ H Sbjct: 289 GTHNMYREYRDLTVSGAVTACYRDMAARHRARGYSIQIMKVEVIPASKARRPHVKQMH 346 >SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +1 Query: 19 YEVIGRKLP-SENEPKPPLYKMRI 87 YEV+G+ + S N+PK PL K+R+ Sbjct: 285 YEVLGKSVNNSRNQPKDPLKKLRV 308 >SB_20318| Best HMM Match : VPS9 (HMM E-Value=7.2) Length = 230 Score = 28.3 bits (60), Expect = 4.9 Identities = 19/73 (26%), Positives = 34/73 (46%) Frame = +1 Query: 337 DTEPELTQYRSSKWK*SRLLRVAVHRSNSSTTAPSDSHCPNVCTTTRDLIPSRTRGLDLL 516 + EP + + S + AV+ ++ P+D++ P+ T R I + D+L Sbjct: 39 EAEPSIVWQQQQPSFISYAVHEAVNVWRNAHHNPADTYVPSPSTMVRAAIMDLSATADML 98 Query: 517 LVIVMYVT*Q*NP 555 L +MYV + NP Sbjct: 99 LNNIMYVIKRANP 111 >SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44) Length = 2581 Score = 28.3 bits (60), Expect = 4.9 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 5/61 (8%) Frame = +1 Query: 7 QLREYEVIGRKLPSENEPKPPLYKMRIFSPD-----PIVAKSRFWYFLRQLKKFKKTTGE 171 +LR Y++I ++LP+E+E K + +I +P+ VA + W L + K F +TG Sbjct: 1424 KLRLYQIISQRLPTEDENKYD-FVTKISTPNATWEREFVANASLW-LLDEEKSFSISTGA 1481 Query: 172 I 174 + Sbjct: 1482 L 1482 >SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) Length = 300 Score = 27.9 bits (59), Expect = 6.4 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 357 SIQIIKVEVIKAAACRRPQVKQFHNSTIRFPLPKRVHHYKRLNT 488 S++I ++ AC P V HN +R + + VHH KR+ T Sbjct: 246 SLEITCFFLLHVNACCNPVVYSLHNPKLRKCMNRLVHH-KRVRT 288 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,314,141 Number of Sequences: 59808 Number of extensions: 384311 Number of successful extensions: 1200 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1193 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -