BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30204 (738 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g46250.2 68418.m05694 RNA recognition motif (RRM)-containing ... 71 8e-13 At5g46250.1 68418.m05693 RNA recognition motif (RRM)-containing ... 71 8e-13 At5g66100.1 68418.m08327 La domain-containing protein similar to... 61 9e-10 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 58 8e-09 At2g43970.2 68415.m05468 La domain-containing protein contains P... 54 7e-08 At2g43970.1 68415.m05467 La domain-containing protein contains P... 54 7e-08 At3g19090.1 68416.m02426 RNA-binding protein, putative similar t... 51 9e-07 At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing ... 48 6e-06 At4g35890.1 68417.m05097 La domain-containing protein contains P... 47 1e-05 At1g79880.1 68414.m09333 La domain-containing protein contains P... 44 1e-04 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 36 0.028 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 33 0.20 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 31 0.60 At3g61570.1 68416.m06896 intracellular protein transport protein... 31 0.80 At5g40870.1 68418.m04963 uracil phosphoribosyltransferase, putat... 30 1.8 At5g27650.1 68418.m03313 PWWP domain-containing protein hypothet... 30 1.8 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 29 2.4 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 29 2.4 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 29 2.4 At1g53650.1 68414.m06105 RNA-binding protein, putative similar t... 29 3.2 At2g20890.1 68415.m02462 expressed protein 29 4.3 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 28 5.6 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 28 5.6 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 28 5.6 At3g14450.1 68416.m01831 RNA-binding protein, putative contains ... 28 7.4 At1g76740.1 68414.m08931 expressed protein weak similarity to fi... 28 7.4 At5g49580.1 68418.m06136 DNAJ heat shock N-terminal domain-conta... 27 9.8 At5g40320.1 68418.m04892 DC1 domain-containing protein contains ... 27 9.8 At4g07690.1 68417.m01209 hypothetical protein includes At2g24900... 27 9.8 At2g41540.2 68415.m05134 NAD-dependent glycerol-3-phosphate dehy... 27 9.8 At2g41540.1 68415.m05133 NAD-dependent glycerol-3-phosphate dehy... 27 9.8 At2g32970.1 68415.m04041 expressed protein 27 9.8 At2g27170.1 68415.m06029 structural maintenance of chromosomes (... 27 9.8 At1g62010.1 68414.m06994 mitochondrial transcription termination... 27 9.8 At1g53440.1 68414.m06057 leucine-rich repeat family protein / pr... 27 9.8 >At5g46250.2 68418.m05694 RNA recognition motif (RRM)-containing protein contains similarity to RNA-binding protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 420 Score = 70.9 bits (166), Expect = 8e-13 Identities = 41/85 (48%), Positives = 55/85 (64%), Gaps = 1/85 (1%) Frame = +1 Query: 256 IIRQVEYYFGDVNLHRDKFLQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNKS 432 IIRQVEYYF D NL DKFL +K + G+VP+ + F+++ KLT D +I +AL +S Sbjct: 107 IIRQVEYYFSDENLPTDKFLLNAMKRNKKGFVPISTIATFHKMKKLTRDHALIVSALKES 166 Query: 433 TSGLLEVSEDNKKVRRNPEQPLPEM 507 + L VS D KKV+R PLPE+ Sbjct: 167 S--FLVVSADEKKVKR--LSPLPEI 187 >At5g46250.1 68418.m05693 RNA recognition motif (RRM)-containing protein contains similarity to RNA-binding protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 422 Score = 70.9 bits (166), Expect = 8e-13 Identities = 41/85 (48%), Positives = 55/85 (64%), Gaps = 1/85 (1%) Frame = +1 Query: 256 IIRQVEYYFGDVNLHRDKFLQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNKS 432 IIRQVEYYF D NL DKFL +K + G+VP+ + F+++ KLT D +I +AL +S Sbjct: 107 IIRQVEYYFSDENLPTDKFLLNAMKRNKKGFVPISTIATFHKMKKLTRDHALIVSALKES 166 Query: 433 TSGLLEVSEDNKKVRRNPEQPLPEM 507 + L VS D KKV+R PLPE+ Sbjct: 167 S--FLVVSADEKKVKR--LSPLPEI 187 >At5g66100.1 68418.m08327 La domain-containing protein similar to SP|P40796 La protein homolog (La ribonucleoprotein) (La autoantigen homolog) {Drosophila melanogaster}; contains Pfam profile PF05383: La domain Length = 453 Score = 60.9 bits (141), Expect = 9e-10 Identities = 28/59 (47%), Positives = 39/59 (66%) Frame = +1 Query: 256 IIRQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANALNKS 432 I+ QVEYYF NL RD+ L++Q+ D+GWVP+ ++ F RLA+LT + I AL S Sbjct: 339 ILTQVEYYFSADNLSRDEHLRDQMN-DEGWVPVRVIAAFRRLAELTNNIQTILEALRSS 396 >At5g21160.1 68418.m02528 La domain-containing protein / proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965, PF05383: La domain Length = 826 Score = 57.6 bits (133), Expect = 8e-09 Identities = 32/87 (36%), Positives = 47/87 (54%) Frame = +1 Query: 256 IIRQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANALNKST 435 +++QVEYYF D NL D +L + ++GWVP +I+ F R+ +T D D I AL S Sbjct: 282 VLKQVEYYFSDENLENDHYLISLMD-EEGWVPTKIIAGFKRVKAMTMDVDFIVYALGFSN 340 Query: 436 SGLLEVSEDNKKVRRNPEQPLPEMTRS 516 S +EV D + R +P +S Sbjct: 341 S--VEVQGDQIRKRDKWSDWIPASKKS 365 >At2g43970.2 68415.m05468 La domain-containing protein contains Pfam profile PF05383: La domain Length = 529 Score = 54.4 bits (125), Expect = 7e-08 Identities = 37/110 (33%), Positives = 59/110 (53%), Gaps = 5/110 (4%) Frame = +1 Query: 256 IIRQVEYYFGDVNLHRDKFLQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNKS 432 I+ QVEYYF D+NL L I D +G+VP+ ++ F ++ + + +A L S Sbjct: 197 IVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINNNSQLAAVLQNS 256 Query: 433 TSGLLEVSEDNKKVRR-NP--EQPLPEM-TRSFVKKYATDQFMRKDLLKM 570 L VSED KKVRR +P E + E+ +R V + + ++L+K+ Sbjct: 257 AK--LFVSEDGKKVRRISPITESAIEELQSRIIVAENLPEDHCYQNLMKI 304 >At2g43970.1 68415.m05467 La domain-containing protein contains Pfam profile PF05383: La domain Length = 545 Score = 54.4 bits (125), Expect = 7e-08 Identities = 37/110 (33%), Positives = 59/110 (53%), Gaps = 5/110 (4%) Frame = +1 Query: 256 IIRQVEYYFGDVNLHRDKFLQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNKS 432 I+ QVEYYF D+NL L I D +G+VP+ ++ F ++ + + +A L S Sbjct: 197 IVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHVVASFKKIKAVINNNSQLAAVLQNS 256 Query: 433 TSGLLEVSEDNKKVRR-NP--EQPLPEM-TRSFVKKYATDQFMRKDLLKM 570 L VSED KKVRR +P E + E+ +R V + + ++L+K+ Sbjct: 257 AK--LFVSEDGKKVRRISPITESAIEELQSRIIVAENLPEDHCYQNLMKI 304 >At3g19090.1 68416.m02426 RNA-binding protein, putative similar to RNA-binding protein homolog GB:AAF00075 GI:6449448 from [Brassica napus]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 455 Score = 50.8 bits (116), Expect = 9e-07 Identities = 27/79 (34%), Positives = 48/79 (60%), Gaps = 1/79 (1%) Frame = +1 Query: 256 IIRQVEYYFGDVNLHRDKFLQEQIKLD-DGWVPLEILTKFNRLAKLTEDTDVIANALNKS 432 I++QVEY F D++L ++ + + I D +G+VP+ + ++ LT + +++ AL S Sbjct: 148 IVKQVEYQFTDMSLLANESISKHISKDPEGYVPVSYIASTKKIKALTSNHHLVSLALRSS 207 Query: 433 TSGLLEVSEDNKKVRRNPE 489 + L VSED KKV+R + Sbjct: 208 SK--LVVSEDGKKVKRTSQ 224 >At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing protein RNA-binding protein LAH1, Saccharomyces cerevisiae, PIR2:B48600; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 433 Score = 48.0 bits (109), Expect = 6e-06 Identities = 32/90 (35%), Positives = 51/90 (56%), Gaps = 12/90 (13%) Frame = +1 Query: 256 IIRQVEYYFGDVNLHRDKFLQEQI-KLDDGWVPLEILTKFNRLA-----------KLTED 399 ++RQVE+YF D NL D FL++ + + +DG V L ++ F+++ + ED Sbjct: 14 VLRQVEFYFSDSNLPIDDFLKKTVTESEDGLVSLALICSFSKMRGYLKLGDSKGDDIPED 73 Query: 400 TDVIANALNKSTSGLLEVSEDNKKVRRNPE 489 T + A A TS L++S+D KKV R+ E Sbjct: 74 T-IKAVADTLRTSSALKISDDGKKVGRSTE 102 >At4g35890.1 68417.m05097 La domain-containing protein contains Pfam PF05383: La domain Length = 523 Score = 46.8 bits (106), Expect = 1e-05 Identities = 26/74 (35%), Positives = 44/74 (59%) Frame = +1 Query: 262 RQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANALNKSTSG 441 +Q++YYF D NL D +L+ + ++G+VPL ++ F ++A+LT++ I AL S Sbjct: 375 KQIQYYFSDENLITDIYLRGFMN-NEGFVPLRVVAGFKKVAELTDNIQQIVEALQNSPH- 432 Query: 442 LLEVSEDNKKVRRN 483 +EV D + R N Sbjct: 433 -VEVQGDFIRKRDN 445 >At1g79880.1 68414.m09333 La domain-containing protein contains Pfam profile PF05383: La domain; similar to putative protein GB:CAA18589 [Arabidopsis thaliana] Length = 399 Score = 43.6 bits (98), Expect = 1e-04 Identities = 32/96 (33%), Positives = 49/96 (51%), Gaps = 13/96 (13%) Frame = +1 Query: 256 IIRQVEYYFGDVNLHRDKFLQEQI-KLDDGWVPLEILTKFNRLAKL-------TED---- 399 ++ QVE+YF D NL D FL ++ K DG V L ++ F+R+ L ED Sbjct: 13 LLTQVEFYFSDSNLPTDGFLNREVTKSKDGLVSLPLVCSFSRMRNLLGLGNINREDIPPR 72 Query: 400 -TDVIANALNKSTSGLLEVSEDNKKVRRNPEQPLPE 504 + +AN L TS L+VS + +++ R + PE Sbjct: 73 IVEEVANLLR--TSDFLKVSNNGQRIGRGTKLSKPE 106 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 35.9 bits (79), Expect = 0.028 Identities = 20/70 (28%), Positives = 38/70 (54%) Frame = +3 Query: 510 EELRKEICNRSIYAKGFAKDASLDDLLNYFKQFQEVENVIMRRYVEKSTKKRLFKGSVFA 689 E ++I R+I+ +GF D + ++L F+ + E+E + ++K T + KG F Sbjct: 399 ESADRDIAQRNIFVRGFGWDTTQENLKTAFESYGEIEECSV--VMDKDTGRG--KGYGFV 454 Query: 690 TFQTREXGRK 719 F+TR+ R+ Sbjct: 455 MFKTRKGARE 464 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/65 (29%), Positives = 35/65 (53%) Frame = +3 Query: 522 KEICNRSIYAKGFAKDASLDDLLNYFKQFQEVENVIMRRYVEKSTKKRLFKGSVFATFQT 701 +++ +R I+ G D D L++ FKQ+ E+E+ + V+K + + KG F F++ Sbjct: 123 EDLVHRKIFVHGLGWDTKADSLIDAFKQYGEIED--CKCVVDKVSGQS--KGYGFILFKS 178 Query: 702 REXGR 716 R R Sbjct: 179 RSGAR 183 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 31.5 bits (68), Expect = 0.60 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +3 Query: 543 IYAKGFAKDASLDDLLNYFKQFQEVENVIMRRYVEKSTKKRLFKGSVFATF 695 I+ ++AS+DDL +YF +F +++ Y+ K K+ +G F TF Sbjct: 242 IFVGRLPQEASVDDLRDYFGRFGHIQDA----YIPKDPKRSGHRGFGFVTF 288 >At3g61570.1 68416.m06896 intracellular protein transport protein USO1-related contains weak similarity to intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae] Length = 712 Score = 31.1 bits (67), Expect = 0.80 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 3/101 (2%) Frame = +1 Query: 250 YWIIRQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNR--LAKLTEDTDVIANAL 423 Y I E++ ++ + +D+ ++ +L D LE K +KL V A Sbjct: 472 YAEIEAKEHFERELAMAKDELMKLSARLKDSDERLESSNKEKEDVTSKLLHAEKVAAEWK 531 Query: 424 NKSTSGLLEVSEDNKKVRRNPEQPLPEMTR-SFVKKYATDQ 543 N+ T +V EDN KVRR EQ + + R S Y D+ Sbjct: 532 NRVT----KVEEDNAKVRRVLEQSMTRLNRMSMESDYLVDR 568 >At5g40870.1 68418.m04963 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 486 Score = 29.9 bits (64), Expect = 1.8 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = -2 Query: 503 SGSGCSGLRLTFLLSSETSNNPLVDLLRAFAMTSVSSVS---LARRLNFVRISNGTHPSS 333 SG SGLR LLSS N+ +V LR+ +S S S ++ + +S GT Sbjct: 16 SGPHFSGLRFDGLLSSSPPNSSVVSSLRSAVSSSSPSSSDPEAPKQPFIIGVSGGTASGK 75 Query: 332 NFIC 321 +C Sbjct: 76 TTVC 79 >At5g27650.1 68418.m03313 PWWP domain-containing protein hypothetical protein F22F7.12 - Arabidopsis thaliana, EMBL:AC009606 Length = 1072 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +2 Query: 122 LKSEGIFH*RKIKMTEDKEVTVETNGQEENAKTENSE-DETELDIGL 259 +KSE + + + +E KE E +G ++ + SE DE ELD+GL Sbjct: 87 IKSEDVLIDKDDESSEVKEEEEEEDGSDDQSSELGSEADEKELDLGL 133 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 29.5 bits (63), Expect = 2.4 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = +3 Query: 543 IYAKGFAKDASLDDLLNYFKQFQEVENVIMRRYVEKSTKKRLFKGSVFATFQTREXGRKV 722 I+ G A + D + YF+QF E+ ++ +K+T + KG F TF+ E + Sbjct: 24 IFVGGLAWETQRDTMRRYFEQFGEIVEAVV--ITDKNTGRS--KGYGFVTFKEAEAAMRA 79 Query: 723 YECQ 734 CQ Sbjct: 80 --CQ 81 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +3 Query: 543 IYAKGFAKDASLDDLLNYFKQFQEVENVIMRRYVEKSTKKRLFKGSVFATFQ 698 ++ G A + D++ YF+QF E+ ++ +K+T K KG F TF+ Sbjct: 19 VFVGGLAWETPTDEMRRYFEQFGEILEAVI--ITDKNTGKS--KGYGFVTFR 66 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +3 Query: 543 IYAKGFAKDASLDDLLNYFKQFQEVENVIMRRYVEKSTKKRLFKGSVFATFQ 698 ++ G A + D++ YF+QF E+ ++ +K+T K KG F TF+ Sbjct: 19 VFVGGLAWETPTDEMRRYFEQFGEILEAVI--ITDKNTGKS--KGYGFVTFR 66 >At1g53650.1 68414.m06105 RNA-binding protein, putative similar to RNA-binding protein GB:AAA86641 GI:1174153 from [Arabidopsis thaliana] Length = 314 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +3 Query: 489 TATARNDEELRKEICNRSIYAKGFAKDASLDDLLNYFK 602 T R+++E +E+C+R+IY K+A+ DD+ +F+ Sbjct: 211 TFLPRSEDE--REMCSRTIYCTNVDKNATEDDVNTFFQ 246 >At2g20890.1 68415.m02462 expressed protein Length = 300 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/69 (21%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +1 Query: 352 LEILTKFNRLAKLTEDTDV-IANALNKSTSGLLEVSEDNKKVRRNPEQPLPEMTRSFVKK 528 + I TKF+RL+ + T + + ++ T+ + VSE K + ++P+P + + +++ Sbjct: 33 IRICTKFSRLSLNSRSTSKSLIHCMSNVTADVPPVSETKSKFLKAYKRPIPSIYNTVLQE 92 Query: 529 YATDQFMRK 555 Q + + Sbjct: 93 LIVQQHLMR 101 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +3 Query: 534 NRSIYAKGFAKDASLDDLLNYFKQFQEVENVIMRRYVEKSTKKRLFKGSVFATFQTREXG 713 +R I+ G D + L+ FKQ+ E+E+ + +K + K KG F +++R Sbjct: 139 HRKIFVHGLGWDTKTETLIEAFKQYGEIED--CKAVFDKISGKS--KGYGFILYKSRSGA 194 Query: 714 R 716 R Sbjct: 195 R 195 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +3 Query: 534 NRSIYAKGFAKDASLDDLLNYFKQFQEVENVIMRRYVEKSTKKRLFKGSVFATFQTREXG 713 +R I+ G D + L+ FKQ+ E+E+ + +K + K KG F +++R Sbjct: 139 HRKIFVHGLGWDTKTETLIEAFKQYGEIED--CKAVFDKISGKS--KGYGFILYKSRSGA 194 Query: 714 R 716 R Sbjct: 195 R 195 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +3 Query: 534 NRSIYAKGFAKDASLDDLLNYFKQFQEVENVIMRRYVEKSTKKRLFKGSVFATFQTREXG 713 +R I+ G D + L+ FKQ+ E+E+ + +K + K KG F +++R Sbjct: 139 HRKIFVHGLGWDTKTETLIEAFKQYGEIED--CKAVFDKISGKS--KGYGFILYKSRSGA 194 Query: 714 R 716 R Sbjct: 195 R 195 >At3g14450.1 68416.m01831 RNA-binding protein, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (2 copies) Length = 327 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 489 TATARNDEELRKEICNRSIYAKGFAKDASLDDLLNYFK 602 T R+++E +E+C R+IY K S D+ N+F+ Sbjct: 224 TFLPRSEDE--REMCTRTIYCTNIDKKVSQADVRNFFE 259 >At1g76740.1 68414.m08931 expressed protein weak similarity to fimbriae-associated protein Fap1 (GI:3929312) [Streptococcus parasanguinis]; weak similarity to 1MDa_1 protein (GI:24620455) [Caenorhabditis elegans] Length = 1532 Score = 27.9 bits (59), Expect = 7.4 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +1 Query: 352 LEILTKF-NRLAKLTEDTDVIANALNKSTSGLLEVSEDNKKVRRNPEQPLPEMTRS 516 +E+ T+ + L K TE T +L++ + +LE KKVR +PE + E TRS Sbjct: 27 IEMATRLASVLQKETEGTLTDTISLSEDSVDVLEDDVAVKKVRFSPENEVFEFTRS 82 >At5g49580.1 68418.m06136 DNAJ heat shock N-terminal domain-containing protein contains similarity to S-locus protein 5 GI:6069485 from [Brassica rapa]; contains Pfam profile PF00226 DnaJ domain Length = 695 Score = 27.5 bits (58), Expect = 9.8 Identities = 22/84 (26%), Positives = 37/84 (44%) Frame = +3 Query: 486 RTATARNDEELRKEICNRSIYAKGFAKDASLDDLLNYFKQFQEVENVIMRRYVEKSTKKR 665 R A A + E+ S+ K + + ++LLNYF++FQ +K T+ Sbjct: 447 RAAEAFKKLQNAYEVLLDSVKQKSYDDELKREELLNYFRRFQNSS--------QKDTRGH 498 Query: 666 LFKGSVFATFQTREXGRKVYECQR 737 F GS F + + E EC++ Sbjct: 499 GFSGSGFGSSE-GEGEEAFRECRQ 521 >At5g40320.1 68418.m04892 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 594 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 495 TARNDEELRKEICNRSIYAKGFAKDASLDDLL 590 T R+DE +R C R +YA F DD + Sbjct: 314 TNRHDENIRCRACVRPVYANTFYSCMQCDDFI 345 >At4g07690.1 68417.m01209 hypothetical protein includes At2g24900, At5g35040, At3g30500, At4g07690 Length = 248 Score = 27.5 bits (58), Expect = 9.8 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -2 Query: 656 CGFLNVSSHNYILNFLKLLEV 594 CGF+ ++H Y++ F+ +EV Sbjct: 82 CGFVRSTTHKYMIEFMNAIEV 102 >At2g41540.2 68415.m05134 NAD-dependent glycerol-3-phosphate dehydrogenase family protein weak similarity to SP|P46919 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) {Bacillus subtilis}; contains Pfam profile PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase Length = 462 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +1 Query: 259 IRQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANAL 423 ++ VE GD L+ D+ L++ L+ PL L L + D D++ N L Sbjct: 112 LKYVEARLGDRTLYADEILKDGFCLNMVDTPLCPLKVVTNLQEAVWDADIVVNGL 166 >At2g41540.1 68415.m05133 NAD-dependent glycerol-3-phosphate dehydrogenase family protein weak similarity to SP|P46919 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) {Bacillus subtilis}; contains Pfam profile PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase Length = 462 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +1 Query: 259 IRQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANAL 423 ++ VE GD L+ D+ L++ L+ PL L L + D D++ N L Sbjct: 112 LKYVEARLGDRTLYADEILKDGFCLNMVDTPLCPLKVVTNLQEAVWDADIVVNGL 166 >At2g32970.1 68415.m04041 expressed protein Length = 577 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -3 Query: 715 LPCSLVWNVANTEPLNKRFFVDFSTYLLIITFSTS*NCL 599 LP SLVWNV NT L + + Y I + NCL Sbjct: 417 LPISLVWNVTNTVLLPLFWIIWEVVYAPIRVVAALANCL 455 >At2g27170.1 68415.m06029 structural maintenance of chromosomes (SMC) family protein similar to basement membrane-associated chondroitin proteoglycan Bamacan [Rattus norvegicus] GI:1785540; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain. No suitalble start codon was identified. Length = 1207 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/84 (20%), Positives = 38/84 (45%) Frame = +1 Query: 262 RQVEYYFGDVNLHRDKFLQEQIKLDDGWVPLEILTKFNRLAKLTEDTDVIANALNKSTSG 441 + +EY D LH + EQ+++ E ++R+ K +D+ + +L + T Sbjct: 221 KSLEYTIYDKELHDAREKLEQVEVARTKASEESTKMYDRVEKAQDDSKSLDESLKELTKE 280 Query: 442 LLEVSEDNKKVRRNPEQPLPEMTR 513 L + ++ + V + L + T+ Sbjct: 281 LQTLYKEKETVEAQQTKALKKKTK 304 >At1g62010.1 68414.m06994 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 415 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 503 SGSGCSGLRLTFLLSSETSNNPLVDLLRAFAMTSVSSVSLARRLNFVRISN 351 S S LRL L+ + +++ ++DLLR++ T S+ R + V I N Sbjct: 51 SSSFLDSLRLATKLTDKGNSDSVLDLLRSYGFTDSQISSIIRSDSRVLIDN 101 >At1g53440.1 68414.m06057 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1035 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 386 LARRLNFVRISNGTHPSSNFICSCR-NLSR-CRFTS 285 L R+ NFV S P+SN C C N S CR T+ Sbjct: 57 LDRKWNFVAESTSKLPTSNITCDCTFNASSVCRVTN 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,937,148 Number of Sequences: 28952 Number of extensions: 292390 Number of successful extensions: 1162 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1147 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -