BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30196 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding pr... 23 7.8 AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-b... 23 7.8 AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding pr... 23 7.8 >AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding protein AgamOBP3 protein. Length = 153 Score = 23.4 bits (48), Expect = 7.8 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +3 Query: 462 GFKNKRGRKHYLSLSVALGSYRALYLLNWVYR 557 G N +G HY+ + L L LNW R Sbjct: 91 GVVNDKGEFHYVKIQDFLPESMHLITLNWFKR 122 >AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-binding protein OBPjj15 protein. Length = 153 Score = 23.4 bits (48), Expect = 7.8 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +3 Query: 462 GFKNKRGRKHYLSLSVALGSYRALYLLNWVYR 557 G N +G HY+ + L L LNW R Sbjct: 91 GVVNDKGEFHYVKIQDFLPESMHLITLNWFKR 122 >AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding protein protein. Length = 153 Score = 23.4 bits (48), Expect = 7.8 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +3 Query: 462 GFKNKRGRKHYLSLSVALGSYRALYLLNWVYR 557 G N +G HY+ + L L LNW R Sbjct: 91 GVVNDKGEFHYVKIQDFLPESMHLITLNWFKR 122 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 806,096 Number of Sequences: 2352 Number of extensions: 17933 Number of successful extensions: 70 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -